SecReT6
Protein ID: 333914604
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2974
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3352129..3353154 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDF6AQK6
KEGG IDdel:DelCs14_2974
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-22, Aligned region: 40..49
ImpA-rel_N [PF06812], Evalue: 1.10E-22, Aligned region: 53..113
ImpA-rel_N [PF06812], Evalue: 1.10E-22, Aligned region: 179..201
Protein Sequence: 341 a.a.     [Download]
>gi|333914604|ref|YP_004488336.1| type VI secretion-associated protein, ImpA family [Delftia sp. Cs1-4]
MANIQDLLTETAAEPPCGPDLTYDNDFQAMESAAQGKVEQQFGDTVIPAEPPDWRDVERQASALMQRTKD
LRVAVLLCRAWTILHGLPGTLQGLQLCGALLERHWEHVHPLPEDGDDYFMRMNALGTLSDVTGFVRDLRN
ADFLRGALGQISVRDAELMAKGNVPEDLPHLTADELRMASARAHAEGHETLLAVTPALQELDQIRACCEQ
HLPSHQQPELDGLRQLLLALKQWQPQSTGDADTAAEADPAAQTGTEGGTVAHPAPGSAPAPARNREQAIA
QLLEIAAFVERTEPSNPAPLLIRRAARFMRMGFMDILRELSPDSLAQVEVITGAHLQEPQT
 
Nucleotide Sequence: 1026 bp     [Download]
>ref|NC_015563.1|:c3353154-3352129 type VI secretion-associated protein, ImpA family [Delftia sp. Cs1-4]
ATGGCCAATATCCAGGACCTGCTGACCGAGACCGCCGCCGAGCCGCCCTGCGGCCCGGACCTTACCTATG
ACAACGATTTCCAGGCCATGGAAAGCGCTGCGCAGGGCAAGGTAGAACAGCAGTTCGGCGACACCGTCAT
CCCCGCCGAGCCACCGGATTGGCGCGACGTGGAGCGCCAAGCCTCGGCCCTGATGCAGCGCACCAAGGAC
CTGCGCGTGGCCGTGCTGCTGTGCCGCGCCTGGACCATCCTGCACGGCCTGCCCGGCACGCTGCAGGGCC
TGCAGCTGTGCGGCGCCCTGCTGGAGCGCCACTGGGAGCATGTCCACCCCCTGCCCGAGGATGGCGACGA
CTACTTCATGCGCATGAACGCCCTGGGCACCCTGTCGGACGTGACAGGCTTTGTGCGTGACCTGCGCAAC
GCCGACTTCCTGCGCGGCGCGCTGGGCCAGATCAGCGTGCGCGACGCCGAACTGATGGCCAAGGGCAACG
TGCCCGAGGACCTGCCGCACCTGACCGCCGACGAATTGCGCATGGCCTCGGCCCGCGCGCATGCCGAGGG
CCACGAAACCCTGCTGGCCGTCACCCCTGCGCTGCAGGAACTCGACCAGATCCGCGCCTGCTGCGAACAG
CACCTGCCCAGCCACCAGCAGCCCGAGCTCGACGGCCTGCGCCAGCTGCTGCTGGCCCTCAAGCAATGGC
AGCCCCAGTCCACAGGCGATGCCGACACGGCCGCCGAAGCCGATCCGGCCGCACAAACCGGCACAGAGGG
CGGCACGGTGGCCCACCCCGCGCCAGGCTCGGCACCCGCCCCGGCGCGCAACCGCGAACAGGCGATTGCC
CAGTTGCTGGAAATCGCCGCCTTCGTGGAGCGCACCGAGCCCTCCAACCCCGCCCCCCTGCTCATCCGCC
GCGCCGCCCGCTTCATGCGCATGGGCTTCATGGACATCCTGCGCGAACTGTCGCCCGACAGCCTGGCCCA
GGTGGAAGTGATCACGGGCGCCCACCTGCAGGAGCCGCAGACATGA