SecReT6
Protein ID: 333914607
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2977
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3357559..3358890 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDF6ARE0
KEGG IDdel:DelCs14_2977
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.90E-70, Aligned region: 49..254
OmpA [PF00691], Evalue: 8.20E-15, Aligned region: 280..304
OmpA [PF00691], Evalue: 8.20E-15, Aligned region: 317..415
Protein Sequence: 443 a.a.     [Download]
>gi|333914607|ref|YP_004488339.1| DotU family type IV / VI secretion system protein [Delftia sp. Cs1-4]
MNSSNISHQMPWGGDADTGRAEGAASAAPAPAGQEPLRSNLPDVVSGGNPLVAAANRLLNLIPQIRAMVT
NEDPRALQQLLLEHIREFEQRAGASGVPMETIIGARYCICTVLDETAAQTPWGSAGVWPKHSLLVALHNE
TWGGEKFFQLLARLVQTPHQHIDLIELLYYCVMLGFEGRYRVIDNGRAQLETLKARLLQLIESTRGDRSS
LLSVHWRGVQRLASPPWAMVPLWVAAAITLLLAFFIYLWFSYRLSNSSDDLFAAINEIRFPRTSAAATVA
TIKPRLRQFLEPEIREGLVSVRDEADRSTVILRGDGLFDPAATVVKPRYVQVIHRVAAALDEVPGKVVVN
GYTDNLPIRTARFPSNWNLSQERAQAVSQMLGGSLRDRQRLHAEGRADSDPVAPNNTAEGRALNRRVEIV
LLVAPQQRDQQLQALPAAPETRN
 
Nucleotide Sequence: 1332 bp     [Download]
>ref|NC_015563.1|:c3358890-3357559 DotU family type IV / VI secretion system protein [Delftia sp. Cs1-4]
ATGAACAGTTCCAACATCAGCCACCAAATGCCCTGGGGCGGCGACGCCGACACGGGCCGTGCCGAAGGTG
CGGCCAGCGCCGCGCCCGCGCCTGCCGGCCAGGAGCCGCTGCGCTCCAACCTGCCCGACGTGGTCAGCGG
CGGCAACCCGCTGGTGGCCGCCGCCAACCGGCTGCTGAACCTCATCCCCCAGATCCGCGCCATGGTCACC
AACGAGGACCCGCGCGCGCTGCAACAACTGCTGCTCGAGCACATCCGCGAGTTCGAGCAGCGCGCAGGCG
CCAGCGGCGTGCCCATGGAAACCATCATCGGTGCACGCTACTGCATCTGCACGGTGCTGGACGAGACCGC
CGCCCAGACGCCCTGGGGCAGTGCCGGCGTCTGGCCCAAGCACAGCCTGCTGGTCGCCCTGCACAACGAA
ACCTGGGGCGGCGAGAAGTTCTTCCAGCTGCTGGCCCGCCTGGTGCAGACGCCGCACCAGCACATCGACC
TGATCGAGCTGCTGTACTACTGCGTGATGCTGGGCTTTGAAGGCCGCTACCGCGTGATCGACAACGGCCG
CGCCCAGCTGGAGACGCTGAAGGCGCGCCTGCTGCAGCTCATCGAATCCACGCGCGGCGACCGCAGCAGC
CTGCTGTCCGTGCACTGGCGTGGCGTGCAGCGCCTGGCCTCGCCGCCCTGGGCCATGGTGCCGCTGTGGG
TGGCCGCGGCCATCACCTTGCTGCTGGCGTTCTTCATCTACCTGTGGTTCAGCTACCGGCTGTCCAACAG
TTCGGACGACCTGTTCGCCGCCATCAACGAGATCCGGTTCCCGCGCACCTCGGCGGCCGCCACCGTGGCC
ACCATCAAGCCGCGGCTGCGCCAGTTCCTGGAGCCCGAGATCCGCGAAGGCCTGGTCAGCGTGCGCGACG
AGGCCGACCGCAGCACCGTCATCCTGCGCGGAGACGGCCTGTTCGACCCGGCCGCCACCGTCGTCAAGCC
CCGCTACGTGCAGGTCATCCACCGCGTGGCAGCGGCGCTGGACGAAGTGCCGGGCAAGGTCGTCGTCAAC
GGCTACACCGACAACCTGCCCATCCGCACGGCGCGCTTCCCGTCCAACTGGAACCTGTCGCAGGAACGTG
CCCAGGCCGTGTCCCAGATGCTGGGCGGCTCGCTGCGCGACCGCCAGCGCCTGCATGCCGAGGGCCGTGC
CGACAGCGACCCCGTCGCCCCCAACAACACGGCAGAAGGCCGGGCGCTGAACCGGCGGGTGGAAATCGTC
CTGCTGGTCGCACCCCAGCAACGTGACCAGCAACTGCAGGCCCTGCCTGCCGCACCCGAGACCAGGAACT
GA