SecReT6
Protein ID: 333914608
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2978
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3358912..3360246 [-]
Producttype VI secretion lipoprotein
NoteTssK
UniProt IDF6ARE1
KEGG IDdel:DelCs14_2978
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.90E-159, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|333914608|ref|YP_004488340.1| type VI secretion lipoprotein [Delftia sp. Cs1-4]
MVWQRKVIWAEGMFLRPQHFQQQERFLFRQLQSRSLPGQPFFWGFSELELDTDLLRMGKLGIRSAHGVLP
DGTPFQLPGDDEAPTPLDIGKDFKDVVVHLALPLRRFSGSEVTFGEGSQSPARYLSDVTEVADSNDVGAQ
PAEVQLGRLRLSLRPAHELTEGWVSLPVAHVVERQASGGVLLEPGFIPTVVNNGPSSVLNTFCKEIHGLL
RQRGEVLAQRMIQPERGGIGEVGDFLLLQLINHWTGAAQHWVRTASIHPERLFEELLRLAAELTTFDHER
RRPEVLPAYDHDDLRRSFPPLMLELRRSLSSVLEQNAIQIPLHDRQYGVRVALIPSTELLTTCDFVLAAH
AQTTPEFLRTHFPTQTKLGPVERIRDLVNLHLPGVTLRPLPIAPREIPYHAGYNYFEVDTTHDLWNQLQS
SGGLAMHVSGEFPDLQLEFWAIRR
 
Nucleotide Sequence: 1335 bp     [Download]
>ref|NC_015563.1|:c3360246-3358912 type VI secretion lipoprotein [Delftia sp. Cs1-4]
ATGGTCTGGCAACGCAAAGTCATCTGGGCCGAGGGCATGTTCCTTCGGCCCCAGCACTTCCAGCAGCAGG
AGCGCTTCCTGTTCCGGCAACTGCAGTCACGCAGCCTGCCGGGGCAGCCCTTTTTCTGGGGCTTCTCGGA
ACTGGAGCTGGACACCGATCTGCTGCGCATGGGCAAGCTGGGCATCCGTTCGGCCCACGGCGTGCTGCCA
GACGGCACGCCGTTCCAGCTGCCGGGCGACGACGAGGCGCCCACCCCGCTGGACATCGGCAAGGACTTCA
AGGACGTGGTGGTCCACCTGGCGCTGCCGCTGCGCCGCTTCTCGGGCAGCGAAGTGACCTTTGGCGAAGG
CTCCCAGAGCCCTGCGCGCTATCTCAGCGACGTGACCGAAGTGGCGGACAGCAACGACGTGGGTGCCCAG
CCCGCCGAGGTGCAGCTGGGCCGGCTGCGCCTGAGCCTGCGCCCCGCCCACGAGCTGACCGAAGGCTGGG
TCAGCCTGCCTGTGGCCCATGTGGTGGAGCGCCAGGCCAGCGGCGGCGTGCTGCTGGAGCCCGGCTTCAT
CCCCACCGTGGTCAACAACGGGCCCAGCTCGGTGCTCAACACCTTCTGCAAGGAAATCCACGGCCTGCTG
CGCCAGCGCGGCGAAGTGCTGGCCCAGCGCATGATCCAGCCCGAGCGCGGCGGCATCGGCGAGGTCGGCG
ACTTCCTGCTGCTGCAGCTCATCAACCACTGGACGGGCGCGGCCCAGCACTGGGTGCGCACCGCCAGCAT
CCACCCCGAGCGCCTGTTCGAGGAACTGCTGCGCCTGGCCGCCGAGCTGACCACCTTCGACCACGAGCGC
CGCCGCCCCGAGGTGCTGCCCGCCTACGACCATGACGACCTGCGGCGCAGCTTCCCTCCGCTGATGCTGG
AGCTGCGGCGCAGCCTGTCCTCGGTGCTGGAGCAAAACGCCATCCAGATCCCGCTGCACGACCGCCAGTA
CGGCGTGCGCGTGGCGCTGATCCCGTCCACCGAACTGCTCACCACCTGCGACTTCGTGCTGGCCGCCCAT
GCCCAGACCACGCCGGAATTCCTGCGCACCCACTTCCCCACCCAGACCAAGCTGGGCCCCGTGGAGCGCA
TACGCGACCTGGTGAACCTGCACCTGCCCGGCGTCACGCTGCGGCCCCTGCCCATTGCCCCGCGCGAGAT
TCCCTACCACGCGGGCTACAACTATTTCGAGGTGGACACCACGCACGATCTGTGGAACCAGCTGCAAAGC
TCCGGCGGCCTTGCCATGCACGTCTCCGGCGAATTCCCCGACCTGCAACTGGAGTTCTGGGCCATCCGCC
GCTGA