SecReT6
Protein ID: 333914609
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2979
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3360264..3360863 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDF6ARE2
KEGG IDdel:DelCs14_2979
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.60E-33, Aligned region: 32..188
Protein Sequence: 199 a.a.     [Download]
>gi|333914609|ref|YP_004488341.1| type VI secretion lipoprotein [Delftia sp. Cs1-4]
MWRSEEPQGSQGRRQALQTLGALGLGTAVVTGLAGCGSLNPLSRAPEVAPTAVPTAIFEVVADMDINPDR
EGIPKPVLLRIYELRASAAFDRAGFFDLQDKDDGQLGSDFVRREEFLVAPGQRQVIERKGNPDVRAFGLF
AAYRDLERSTWRASAVAPNSVELRRRWWGMGSTEKLQPVRYQVHLTREEVTVRIQPASQ
 
Nucleotide Sequence: 600 bp     [Download]
>ref|NC_015563.1|:c3360863-3360264 type VI secretion lipoprotein [Delftia sp. Cs1-4]
ATGTGGAGATCAGAGGAACCGCAGGGATCGCAGGGGCGCCGGCAGGCGCTGCAAACGCTGGGCGCCTTGG
GCCTGGGCACGGCCGTGGTGACCGGCCTGGCCGGCTGCGGCTCCCTCAACCCCCTGAGCCGCGCGCCCGA
AGTGGCGCCCACAGCCGTTCCCACCGCCATATTCGAAGTGGTGGCGGACATGGACATCAACCCGGACCGT
GAAGGCATTCCCAAGCCCGTGCTGCTGCGCATCTACGAGCTGCGCGCCTCCGCCGCCTTCGACCGCGCCG
GCTTCTTCGACCTGCAGGACAAGGACGACGGCCAGCTGGGCAGCGACTTCGTGCGGCGCGAGGAATTCCT
GGTCGCGCCCGGCCAGCGCCAGGTCATAGAGCGCAAGGGCAACCCCGATGTGCGCGCCTTCGGCCTGTTC
GCCGCCTACCGCGATCTGGAGCGCAGCACCTGGCGCGCCTCGGCCGTCGCGCCCAACTCCGTGGAGCTGC
GCAGGCGCTGGTGGGGCATGGGCTCCACCGAAAAGCTGCAGCCCGTGCGCTACCAGGTGCACCTGACCCG
CGAAGAGGTCACCGTCCGCATTCAACCCGCATCCCAATAA