SecReT6
Protein ID: 333914611
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2981
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3361668..3363752 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDF6ARE4
KEGG IDdel:DelCs14_2981
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.40E-07, Aligned region: 30..97
Protein Sequence: 694 a.a.     [Download]
>gi|333914611|ref|YP_004488343.1| FHA domain-containing protein [Delftia sp. Cs1-4]
MDKIELRVVDHDGVPVDRHWHAVFGMAGGTIGRSGQNKLIISDPDASVARVHAMVRLDSEGAFVANLSER
DPIWVAEQPVRSGQEVGLPLGARIRIGAYTLAAVAPGTPFEAPPSAAMQNAQAAQATQTAAPAATAAPQP
QIAPPPVAAQPPLPEAAPLAEAAPLADVLPAAAPGIADPWEGLTALSLDAIQTPAVPSIESAIPPEQAAL
AMPQPAKPQHRPLLIPNDFDPFAPPPQQARQQEEGWAGLPSQGTGELIQQRHDGMVHTLPLKGLSTEALH
DASHTGLPSCFEQSQKLDPLALFDQGGLPPDAQPLQQASGRGSELGQAFNLPRMQSHAQPAEPAPPQEAA
APAQPALPPVIDTVIPAVQEQLPVQVEARAQVQTQVPTQAQDIPVAAPAPAPVPQIPAEPAALDGLLPTN
GLDLDLFKSGLAHVAPVARAAVAPTSAPLDTGINVNIPAASSILGQGDAAIPIGALPSTAAPVDIPVQPQ
PAANADLQALAAAFMEGAGLNPAKTHFEVTPEFMRTFGEALRIAVQGTIDLLAARSEIKREFRAGVTIIA
TGANNPLKFLPNSEGVLMQMVHQTFPGFMKPLPAMQDAFQDLHVHQLALMAGIRAAYAEALTRFDPTELE
RRTETNPGLLDKLLTNGRKAALWDDYKHNFDVLRRHAEDDLMAFSGRTFVEAYENAEQSVKGQP
 
Nucleotide Sequence: 2085 bp     [Download]
>ref|NC_015563.1|:c3363752-3361668 FHA domain-containing protein [Delftia sp. Cs1-4]
ATGGACAAAATCGAACTCAGGGTCGTGGACCACGATGGCGTTCCGGTCGATCGCCACTGGCATGCCGTAT
TCGGCATGGCCGGTGGCACGATCGGACGCAGTGGCCAGAACAAGCTCATCATCTCGGACCCGGACGCTTC
CGTCGCGCGCGTGCACGCCATGGTCAGGCTGGATTCCGAGGGAGCCTTTGTTGCGAACCTGAGCGAGCGT
GATCCCATCTGGGTGGCAGAGCAGCCCGTGCGTTCGGGCCAGGAAGTGGGCCTGCCCCTGGGTGCGCGCA
TCCGTATCGGCGCCTACACCCTGGCCGCCGTGGCGCCGGGCACGCCTTTCGAGGCACCGCCTTCGGCTGC
AATGCAAAACGCGCAGGCCGCGCAAGCAACGCAGACAGCGGCCCCAGCCGCCACAGCCGCCCCGCAGCCC
CAGATCGCCCCGCCTCCCGTCGCCGCCCAGCCCCCGCTGCCGGAAGCAGCGCCGCTGGCAGAGGCAGCGC
CGCTGGCAGACGTATTGCCTGCCGCCGCCCCCGGCATCGCCGATCCCTGGGAAGGCCTGACGGCACTGAG
CCTGGATGCCATCCAGACCCCTGCCGTGCCTTCGATCGAGAGCGCCATCCCGCCCGAGCAGGCTGCACTG
GCCATGCCGCAGCCCGCCAAGCCGCAGCATCGCCCCCTGCTGATCCCCAATGATTTCGACCCCTTTGCTC
CGCCGCCCCAGCAGGCTCGGCAGCAGGAGGAAGGCTGGGCCGGCCTGCCATCGCAAGGCACGGGCGAGCT
GATACAGCAGCGCCATGACGGCATGGTCCACACCCTGCCGCTCAAGGGCCTGAGCACCGAGGCCTTGCAT
GATGCCTCCCATACCGGCCTGCCTTCGTGCTTCGAGCAATCCCAAAAGCTCGACCCGCTTGCGCTGTTCG
ACCAGGGTGGCCTGCCCCCCGATGCGCAGCCGCTGCAGCAGGCCTCGGGCCGGGGCTCCGAACTGGGCCA
GGCCTTCAATCTGCCGCGCATGCAGTCGCATGCACAGCCCGCAGAGCCGGCGCCACCGCAGGAGGCGGCA
GCACCGGCCCAGCCCGCACTCCCGCCTGTGATCGATACCGTGATTCCTGCAGTGCAGGAGCAGCTTCCTG
TACAGGTAGAGGCGCGGGCACAGGTACAGACGCAGGTACCGACGCAGGCACAGGACATCCCGGTTGCCGC
GCCTGCCCCGGCGCCCGTGCCCCAGATCCCCGCCGAGCCGGCCGCTCTGGACGGTCTGCTGCCCACCAAT
GGACTGGATCTGGACCTCTTCAAGTCCGGTCTTGCCCATGTTGCGCCCGTCGCCAGGGCTGCCGTTGCCC
CTACCTCGGCCCCCCTTGACACAGGCATCAACGTCAATATCCCCGCGGCCTCCAGCATCCTCGGCCAGGG
CGACGCCGCCATTCCCATCGGCGCCCTGCCCTCCACCGCCGCGCCTGTCGATATTCCCGTGCAGCCCCAG
CCGGCCGCCAACGCCGATCTGCAGGCACTGGCCGCAGCCTTCATGGAAGGCGCAGGCCTGAACCCGGCCA
AGACCCATTTCGAGGTCACACCGGAATTCATGCGCACTTTCGGCGAGGCCCTGCGCATTGCGGTGCAGGG
AACCATCGACCTGCTGGCCGCGCGCTCCGAGATCAAGCGCGAGTTCCGCGCCGGCGTGACCATCATTGCC
ACGGGGGCCAACAACCCGCTCAAGTTCCTGCCCAATTCCGAGGGCGTGCTCATGCAGATGGTCCACCAGA
CCTTCCCGGGTTTCATGAAGCCGCTGCCCGCCATGCAGGACGCCTTCCAGGACCTGCATGTGCACCAGCT
GGCCCTGATGGCCGGCATCCGCGCCGCCTATGCCGAGGCCCTGACCCGGTTCGATCCGACCGAGCTGGAG
CGCCGCACCGAAACCAACCCCGGCCTGCTGGACAAGCTGCTGACCAATGGCCGCAAGGCCGCGCTGTGGG
ACGACTACAAGCACAACTTCGACGTGCTGCGCCGCCATGCCGAGGACGACCTGATGGCCTTCTCGGGCCG
CACCTTCGTCGAGGCCTACGAAAACGCCGAGCAGTCCGTGAAAGGCCAGCCGTGA