SecReT6
Protein ID: 333914615
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2985
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3367802..3368284 [+]
Producthypothetical protein
NoteTssD
UniProt IDF6ARE8
KEGG IDdel:DelCs14_2985
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-36, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|333914615|ref|YP_004488347.1| hypothetical protein DelCs14_2985 [Delftia sp. Cs1-4]
MSVDMFMKVEGASGESQDSNHKGWTDIDSFTWGATQPNTMSSGGGAGAGKVSFHDLNVIAKVDKCYPAVL
KHCATGKHLGQVDISLCKAGGSQIEFTKITLTDVMVTNVTVSGANSSDTVTVNYSFQAAKVKTQYWEQTN
QGGKGAESQMGFNIKENREA
 
Nucleotide Sequence: 483 bp     [Download]
>ref|NC_015563.1|:3367802-3368284 hypothetical protein DelCs14_2985 [Delftia sp. Cs1-4]
ATGTCCGTTGATATGTTCATGAAGGTCGAGGGCGCCAGTGGCGAGTCCCAGGATTCCAACCACAAGGGCT
GGACCGACATCGACTCCTTCACCTGGGGTGCTACCCAGCCCAACACCATGTCCAGCGGCGGTGGTGCCGG
CGCCGGCAAGGTGAGCTTCCATGACCTGAACGTCATCGCCAAGGTGGACAAGTGCTACCCCGCCGTGCTC
AAGCACTGCGCCACGGGCAAGCACCTGGGCCAGGTCGACATCTCGCTGTGCAAGGCCGGCGGCTCGCAGA
TCGAGTTCACCAAGATCACCCTGACCGACGTCATGGTGACGAACGTGACCGTCAGCGGCGCCAACTCCTC
TGACACCGTGACCGTGAACTACTCGTTCCAGGCTGCCAAGGTCAAGACCCAGTACTGGGAACAGACCAAC
CAGGGCGGCAAGGGCGCCGAGAGCCAGATGGGCTTCAACATCAAGGAAAACCGCGAAGCCTGA