SecReT6
Protein ID: 333982578
SecReT6 ID443
T6SS typei3
Gene symbol-
Locus tagMetme_0850
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]915765..916805 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDG0A6I7
KEGG IDmmt:Metme_0850
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-21, Aligned region: 51..111
Protein Sequence: 346 a.a.     [Download]
>gi|333982578|ref|YP_004511788.1| unnamed protein product [Methylomonas methanica MC09]
MADLLTLLEEISPDNPCGDYLEYDPAYLELGKNIQGKPEDPITGEKAQPPNWRDIQKESLAILQQSKDMQ
VVIYLLRALINLEGLLGFRDALKLLYGLLEKYWDELHPVLDPDDDLDPTTRVNILEELSNFDSVLWPLTL
AALVDSKAVGRYSLRDYHLASDKVEAPEGVTKPDISSIRAAFMDVSEETVAANYQAINDSISLVQQLDAF
VGDKVGIENGPDLSGLSSLLKEIRYVFDQYAETGAGEAEEPSGDEEDGASEAGSGSSSRKAAAVGGVSSR
QDVLRTLDLICKYYRENEPSSPVPILLERAKKLVTADFLQIVQNLLPDGMSQLEQIKGPDPDADQY
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|333981747|ref|NC_015572.1|:915765-916805 Methylomonas methanica MC09 chromosome, complete genome
ATGGCTGATTTGTTAACTTTGTTAGAGGAGATTTCTCCCGATAATCCTTGTGGTGATTATTTGGAGTATG
ACCCCGCCTATCTTGAACTGGGAAAGAACATCCAGGGAAAGCCCGAGGATCCAATCACCGGCGAAAAGGC
CCAGCCGCCTAACTGGCGGGATATTCAGAAAGAATCGCTGGCTATTTTGCAACAAAGTAAGGACATGCAA
GTTGTCATTTATTTGTTGCGCGCATTAATCAATCTTGAAGGACTGCTTGGGTTTCGGGATGCGTTAAAGC
TTTTGTATGGCCTGCTGGAGAAATATTGGGATGAACTGCATCCCGTTCTGGATCCGGATGACGATCTCGA
TCCCACTACGCGCGTTAACATCCTGGAAGAACTCAGTAATTTCGATTCGGTGCTATGGCCTTTAACCTTG
GCCGCATTGGTGGATTCAAAAGCGGTCGGCCGCTATAGCTTGCGCGATTACCACCTGGCTTCCGATAAAG
TCGAAGCGCCGGAAGGCGTTACCAAACCGGATATCAGCAGTATCCGGGCAGCCTTCATGGATGTGTCCGA
AGAAACGGTTGCCGCAAATTATCAGGCGATTAACGACAGCATCAGCCTTGTGCAACAACTGGATGCTTTT
GTCGGCGATAAAGTCGGCATTGAAAATGGCCCCGACCTGTCCGGCTTGTCTTCCCTGCTAAAAGAAATAC
GCTACGTGTTCGATCAATACGCGGAAACCGGCGCGGGCGAAGCGGAAGAGCCATCCGGCGACGAGGAGGA
CGGAGCGAGCGAGGCCGGCTCCGGAAGTTCATCGCGCAAGGCGGCGGCTGTCGGTGGCGTAAGCTCCCGC
CAAGATGTTTTAAGAACGCTGGATTTAATTTGCAAGTATTATCGAGAAAACGAACCCTCCAGTCCCGTAC
CCATTTTGCTGGAGCGGGCAAAAAAATTAGTTACCGCCGATTTTTTGCAAATTGTGCAAAACCTGTTGCC
GGATGGTATGTCCCAGTTAGAGCAGATCAAAGGTCCCGATCCGGATGCGGATCAATATTAA