SecReT6
Protein ID: 333982579
SecReT6 ID443
T6SS typei3
Gene symbol-
Locus tagMetme_0851
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]916832..917368 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDG0A6I8
KEGG IDmmt:Metme_0851
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-58, Aligned region: 9..162
Protein Sequence: 178 a.a.     [Download]
>gi|333982579|ref|YP_004511789.1| unnamed protein product [Methylomonas methanica MC09]
MAESSQKFIQRNRAPRVQIEYDVEVYGSEKKVQLPFVMGVLSDLSGKPSEPLPPIADRKLLEIDVDNFNE
RLKSMKPRTAFQVANTLTGEGNLNVDITFEDMDDFSPAAVAKKVAGLDKIVEARTQLSNLITYMDGKTGA
EELIAKLINDPALLQTLAEKAKPAEAEKPADSAEGSGE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|333981747|ref|NC_015572.1|:916832-917368 Methylomonas methanica MC09 chromosome, complete genome
ATGGCCGAAAGTAGTCAGAAGTTCATTCAACGAAACCGGGCGCCGCGCGTTCAAATCGAATACGATGTGG
AAGTTTACGGCTCCGAGAAAAAAGTACAACTTCCCTTTGTGATGGGTGTGCTTTCCGATCTCTCGGGTAA
ACCTTCCGAACCGTTACCTCCCATTGCCGACCGGAAGTTATTGGAAATAGATGTCGATAACTTCAACGAG
CGTTTGAAATCCATGAAACCCAGAACGGCATTTCAAGTGGCTAATACCCTCACCGGGGAAGGCAACCTGA
ATGTGGATATCACTTTCGAAGACATGGATGATTTTTCTCCCGCAGCGGTAGCCAAAAAGGTGGCTGGTCT
GGATAAAATTGTGGAAGCCAGAACCCAGCTGTCCAACCTGATTACCTATATGGACGGAAAAACCGGCGCC
GAAGAACTGATTGCCAAATTGATCAATGATCCCGCCTTGTTGCAAACGTTGGCCGAAAAAGCCAAACCTG
CCGAAGCGGAAAAACCAGCGGATTCTGCTGAAGGAAGTGGGGAGTAA