SecReT6
Protein ID: 333982580
SecReT6 ID443
T6SS typei3
Gene symbol-
Locus tagMetme_0852
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]917372..918862 [+]
Producttype VI secretion protein
NoteTssC
UniProt IDG0A6I9
KEGG IDmmt:Metme_0852
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.00E-195, Aligned region: 65..491
Protein Sequence: 496 a.a.     [Download]
>gi|333982580|ref|YP_004511790.1| unnamed protein product [Methylomonas methanica MC09]
MAELDAQAQQGATETLEFDDFSALLSKEFKPGTEAANQVNTAVSTLAQFALQDVSKISDDAIKSIQSIIA
SLDEKISEQLNLVLHHPDFQQLEGAWRGLHYLVNNTETDEMLKIKVFNVSKKELGKTLKKFKGTAWDQSP
LFKKLYEEEYGTFGGEPFGCLVGDYHFDHSPPDVELLGEMAKIAAASHTPFLSGVAPSVLQMDSWSELAN
PRDLTKIFQTPEYAAWRSLRDSDDSRYLGLAMPRFLSRLPYGAKTDPVDEFDFEEDTSGADSTKYTWSNA
AYAMAVNINRSFKLYGWCSRIRGIESGGAVEGLPVHTFPTDDGGVDMKCPTEIAITDRREAELAKSGFMP
LIHKKNSDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCMVRDKVGSFKERDDME
KWLTSWINNYVDPNPAMSDELTKSRKPLAAAEVVVEEVEGNPGYYSSKFFLRPHYQLEGLTVSLRLVSKL
PSGKGG
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|333981747|ref|NC_015572.1|:917372-918862 Methylomonas methanica MC09 chromosome, complete genome
ATGGCCGAATTAGATGCACAAGCCCAGCAAGGCGCGACAGAAACTCTGGAGTTCGATGATTTTTCGGCAT
TATTATCCAAAGAATTCAAGCCCGGCACGGAAGCGGCCAATCAGGTCAATACCGCAGTGTCGACCTTGGC
TCAATTCGCCTTGCAAGATGTTTCGAAAATTTCCGATGACGCAATAAAAAGCATACAGTCCATCATTGCC
AGTTTGGACGAAAAAATTTCCGAACAACTGAATTTGGTTTTGCACCACCCCGATTTTCAGCAATTGGAAG
GGGCTTGGCGCGGTTTGCATTATTTGGTGAATAACACTGAAACCGATGAAATGCTGAAAATCAAAGTGTT
CAATGTGTCCAAAAAAGAACTGGGTAAAACCCTGAAAAAATTCAAGGGGACTGCCTGGGATCAAAGTCCG
CTGTTCAAAAAACTGTACGAAGAGGAATACGGCACCTTCGGTGGCGAACCGTTTGGTTGTTTGGTCGGCG
ATTATCATTTCGACCATAGCCCACCGGATGTGGAACTTTTGGGCGAAATGGCAAAAATCGCGGCGGCTTC
GCATACTCCGTTCCTGTCCGGGGTCGCTCCAAGCGTGTTGCAAATGGACAGTTGGTCCGAATTGGCCAAT
CCGCGCGATTTGACTAAAATCTTCCAGACACCGGAATACGCCGCTTGGCGGTCGTTGCGGGACTCGGACG
ACTCGCGTTATCTGGGGCTGGCCATGCCGCGTTTTCTCAGTCGGCTGCCTTATGGCGCCAAAACCGATCC
GGTCGACGAGTTCGATTTTGAAGAGGATACCTCCGGTGCCGACAGCACTAAATACACTTGGTCGAATGCG
GCTTATGCGATGGCGGTCAACATAAACCGTTCCTTTAAACTGTATGGTTGGTGCTCGCGTATCCGCGGCA
TAGAATCGGGCGGTGCCGTGGAAGGTTTGCCGGTACATACCTTCCCGACAGACGATGGTGGGGTTGATAT
GAAGTGTCCGACCGAAATTGCCATTACCGATAGACGTGAAGCCGAACTGGCTAAAAGCGGTTTCATGCCT
TTGATACATAAAAAGAATAGCGACTTTGCCGCATTTATCGGCGCTCAGTCGCTGCAAAAACCGGCCGAGT
ATGACGACCCCGATGCGACAGCGAATGCCAATCTGGCGGCACGTTTGCCTTATTTGTTTGCAACCTGCCG
GTTTGCCCATTACCTGAAGTGTATGGTTCGGGATAAAGTCGGTTCGTTTAAGGAACGCGACGATATGGAG
AAATGGTTGACAAGTTGGATAAACAATTATGTCGACCCGAATCCGGCCATGTCGGACGAACTGACCAAAT
CGCGCAAACCTTTAGCGGCGGCCGAAGTAGTCGTGGAAGAGGTAGAGGGTAACCCTGGCTATTATTCGTC
TAAGTTTTTCTTGAGGCCGCATTATCAATTGGAAGGATTGACTGTGTCGTTGCGGTTGGTTTCCAAATTG
CCTTCTGGAAAAGGTGGCTAA