SecReT6
Protein ID: 333982581
SecReT6 ID443
T6SS typei3
Gene symbol-
Locus tagMetme_0853
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]918983..919465 [+]
Producttype VI secretion system effector
NoteTssD
UniProt IDG0A6J0
KEGG IDmmt:Metme_0853
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-46, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|333982581|ref|YP_004511791.1| unnamed protein product [Methylomonas methanica MC09]
MAVDMFLKIKDVKGEAQDDKHKDTIDVLAWSWGMSNSGSTHMGGGSGAGKVNVQDISVTKYIDKSSPDLM
KACCNGKHFETADLIVRKAGEKPVEYLTITMTDLIVTSVSTGGSGGEDRLTENVTLNFGAVKVKYIEQTA
KGGEGAKPDMGWDIAANKAL
 
Nucleotide Sequence: 483 bp     [Download]
>gi|333981747|ref|NC_015572.1|:918983-919465 Methylomonas methanica MC09 chromosome, complete genome
ATGGCAGTTGATATGTTTTTGAAAATCAAAGATGTAAAAGGTGAAGCACAGGACGACAAGCACAAAGATA
CCATCGACGTGCTGGCCTGGAGTTGGGGGATGTCCAATAGTGGCTCAACTCATATGGGTGGTGGTTCCGG
CGCTGGAAAAGTCAATGTGCAGGATATCAGTGTAACTAAATACATTGACAAAAGTAGTCCTGATCTGATG
AAGGCATGCTGCAACGGTAAACACTTTGAGACAGCGGATTTAATCGTCCGTAAAGCGGGTGAGAAACCGG
TTGAGTATTTAACCATTACGATGACGGATTTGATCGTGACTTCTGTTTCCACTGGCGGCTCGGGCGGTGA
AGATCGTTTGACCGAAAATGTCACGCTTAACTTCGGTGCAGTCAAAGTTAAATACATCGAACAAACCGCG
AAAGGCGGTGAAGGCGCGAAACCCGACATGGGTTGGGATATTGCGGCAAACAAAGCGCTTTAA