SecReT6
Protein ID: 333982582
SecReT6 ID443
T6SS typei3
Gene symbol-
Locus tagMetme_0854
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]919535..920344 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDG0A6J1
KEGG IDmmt:Metme_0854
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.90E-47, Aligned region: 140..262
TPR_16 [PF13432], Evalue: 3.00E-06, Aligned region: 5..56
TPR_16 [PF13432], Evalue: 3.00E-06, Aligned region: 115..160
TPR_16 [PF13432], Evalue: 3.00E-06, Aligned region: 215..242
TPR_19 [PF14559], Evalue: 0.00086, Aligned region: 10..65
TPR_19 [PF14559], Evalue: 0.00086, Aligned region: 114..135
Protein Sequence: 269 a.a.     [Download]
>gi|333982582|ref|YP_004511792.1| unnamed protein product [Methylomonas methanica MC09]
MISSAAEISLKDGRLDDALAQLQDQVRKNPDVAKHRVFLFQLLALNGQWDRALNQLNVCGNLDNANLAMV
QTYREAIRCELLREKIFKGETSPLVFGEPEQWIALLIEACKLSAQSNFTQAGELRDQAFELAPTSSGSFN
GEAFEWIADSDSRLGPVTEAIVNGRYYWIPFNRIAKIEIEAPADLRDLVWLPAQFTWTNGGSAFGLIPSR
YPGSEKAEDAVLRLARKTEWREPAAGHYFGLGQRILITDNGEHALLDTRELIFNTAAAE
 
Nucleotide Sequence: 810 bp     [Download]
>gi|333981747|ref|NC_015572.1|:919535-920344 Methylomonas methanica MC09 chromosome, complete genome
ATGATTTCAAGTGCTGCGGAAATTAGCTTAAAAGACGGACGCCTGGACGATGCGCTGGCGCAATTACAGG
ATCAGGTGCGTAAAAATCCGGATGTGGCTAAGCATCGGGTGTTTTTGTTTCAGCTACTGGCACTTAACGG
ACAGTGGGATCGAGCGCTCAATCAGCTCAACGTCTGCGGTAATTTGGACAATGCGAATTTGGCGATGGTG
CAAACCTACCGGGAAGCCATTCGTTGCGAATTACTACGCGAGAAAATTTTTAAGGGTGAAACGTCGCCTT
TGGTATTCGGCGAGCCCGAACAATGGATTGCATTACTAATCGAAGCGTGCAAGTTGTCGGCGCAATCTAA
CTTTACCCAAGCGGGTGAATTGCGTGATCAGGCTTTCGAGTTGGCGCCGACTTCGTCCGGCAGTTTTAAT
GGCGAGGCGTTCGAATGGATTGCTGATTCGGATAGTCGGCTTGGACCGGTTACGGAAGCGATTGTCAATG
GTCGTTATTATTGGATTCCCTTTAATCGGATCGCCAAAATAGAGATTGAAGCACCGGCCGATCTGCGGGA
TTTGGTCTGGCTGCCGGCCCAATTTACCTGGACCAACGGCGGCAGCGCATTTGGTTTAATTCCATCCCGC
TATCCGGGTAGCGAAAAAGCCGAGGATGCCGTGCTGCGTTTGGCGCGCAAAACGGAATGGCGGGAGCCCG
CGGCCGGCCATTACTTTGGTTTGGGGCAGCGCATTTTGATAACCGACAATGGCGAACATGCTTTATTGGA
TACTCGGGAATTAATCTTTAATACCGCTGCTGCCGAATAA