SecReT6
Protein ID: 333982583
SecReT6 ID443
T6SS typei3
Gene symbol-
Locus tagMetme_0855
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]920347..920850 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDG0A6J2
KEGG IDmmt:Metme_0855
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-21, Aligned region: 37..144
Protein Sequence: 167 a.a.     [Download]
>gi|333982583|ref|YP_004511793.1| unnamed protein product [Methylomonas methanica MC09]
MAELVAKERLQPSLLDRLTDYSPTDKTESREQRVMSYRQLRQSVLRDISWLLNTTAFEALEDLSAAPYVA
RSVINYGIPALSGTNFSSVDAGVLERKLKQAIVDFEPRILADSLRIEIIIASEQMSHNSLSFKIEGDLWA
QPLPVHLFIRSDLDLETGEVTVKEVGG
 
Nucleotide Sequence: 504 bp     [Download]
>gi|333981747|ref|NC_015572.1|:920347-920850 Methylomonas methanica MC09 chromosome, complete genome
ATGGCCGAGCTTGTAGCTAAAGAACGCCTGCAGCCATCCTTGCTGGACAGGCTCACGGACTATTCGCCGA
CGGATAAAACCGAGTCGCGCGAGCAGCGAGTTATGTCTTACCGGCAATTGCGGCAAAGCGTATTACGGGA
TATCAGTTGGCTATTAAATACCACGGCGTTTGAGGCGCTTGAAGACTTGTCCGCCGCGCCTTATGTGGCG
CGTTCCGTTATCAATTACGGCATACCGGCACTTTCCGGCACCAACTTCAGCAGCGTTGATGCCGGCGTAT
TGGAACGCAAATTAAAACAGGCTATCGTCGATTTCGAGCCCAGGATTCTGGCCGATTCGCTTAGAATTGA
AATCATAATCGCCAGTGAACAAATGAGTCATAACTCGCTGTCTTTTAAAATCGAAGGCGATTTATGGGCG
CAACCTTTGCCGGTTCACCTGTTTATTCGTAGCGATCTCGATTTGGAGACCGGCGAAGTCACCGTTAAGG
AAGTGGGTGGTTAG