SecReT6
Protein ID: 333982584
SecReT6 ID443
T6SS typei3
Gene symbol-
Locus tagMetme_0856
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]920853..922736 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDG0A6J3
KEGG IDmmt:Metme_0856
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-215, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|333982584|ref|YP_004511794.1| unnamed protein product [Methylomonas methanica MC09]
MDPRLLHYYNRELQHVREVGAEFASEFPKIAARLGLDAFECSDPYVERLFEGFAFMAARVQLKVDAEFPN
FTQHLLEIVYPHYLAATPSMAVVEFKPDLTEESLAEGFLIDKGSALRSQIAKGEQTACEYQTAHPLQLWP
LEIGQVEYLPSLAAVSSCGLADPTHLQHVKGAIRIVLRCTAGVRFNQLSLDTLPLFLRGAGAIPYRLYEQ
LLANSKALACKFNNGSQVQVKFAGGKHLRGVGFEKDEAMLRYTPRSFDGYRILQEYFAFPERFLFAELSG
LSSLIAECQTDELELFVLLDRSDAQLINALDKANLALFCVPAINLFSKRTDRLHVDRRQSEYHVLVDRTR
PMDYEVFSVEHVAGFGEDRNEQAFLPFYGSKSVYQNQSETAYYMLRRQKRILSSKQRRKGMRSSYIGSEC
FISIVDTEQAPYSPQINQLGLETLCTNRDLPMVMPVGLGDTDFSLQISAPVKSIRCISGPTRPLPAAYAG
ESVWKLINHLSLNYLSLIDSDPKQGAAALRELLSLYAENREPTIKKQIEGVISVNAKNVVRRIDSKGPMV
FGRGLEITVLLDESAFEGGGYFMMGTVLDQFFTRYVSINSFIETVIRTTDRGEVARWPTRIGRRHTF
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|333981747|ref|NC_015572.1|:920853-922736 Methylomonas methanica MC09 chromosome, complete genome
ATGGATCCTCGCCTGCTTCATTACTATAACCGCGAATTGCAGCATGTACGGGAAGTTGGGGCTGAGTTCG
CCAGCGAATTCCCTAAAATTGCCGCTCGTTTAGGTCTGGATGCCTTCGAGTGTTCCGATCCTTACGTAGA
ACGTTTATTCGAAGGGTTTGCTTTTATGGCAGCCCGGGTGCAACTGAAGGTCGATGCCGAATTTCCCAAC
TTTACCCAGCATCTGTTGGAGATTGTCTACCCGCATTATCTGGCCGCTACACCATCAATGGCCGTGGTGG
AATTTAAGCCGGATTTGACGGAAGAAAGTCTGGCGGAAGGTTTTTTGATCGATAAAGGTAGTGCTTTACG
CAGCCAAATCGCCAAAGGTGAGCAAACCGCATGCGAATACCAGACCGCGCATCCCTTGCAACTGTGGCCG
TTGGAAATCGGTCAGGTGGAATACCTACCGTCTTTAGCCGCGGTTTCCAGTTGCGGTTTGGCCGACCCCA
CACATTTGCAACATGTTAAAGGCGCTATCCGCATTGTCCTGCGTTGCACGGCCGGGGTACGATTTAATCA
GCTATCGCTGGACACCTTGCCGCTGTTTTTACGTGGCGCGGGGGCGATTCCTTACCGCTTATATGAACAA
TTATTGGCCAATTCGAAAGCCTTGGCCTGTAAATTTAACAATGGCTCACAAGTCCAGGTTAAATTTGCCG
GCGGCAAACATCTGCGTGGCGTGGGCTTTGAAAAAGACGAAGCCATGTTGCGATATACGCCGAGGTCTTT
CGATGGCTATCGAATTCTGCAGGAATATTTTGCCTTTCCCGAGCGCTTTCTGTTTGCCGAATTATCCGGC
CTTTCGTCATTAATTGCCGAGTGCCAAACCGATGAACTGGAGTTGTTCGTCTTATTGGACCGCAGCGATG
CGCAACTGATCAATGCGTTGGATAAAGCCAATCTGGCCTTGTTCTGCGTGCCGGCCATAAACCTGTTTTC
TAAGCGCACCGACCGCTTGCACGTGGATCGCCGCCAGTCGGAATACCATGTGCTGGTGGACCGCACGCGA
CCGATGGATTACGAAGTTTTCAGCGTCGAGCATGTGGCGGGTTTCGGCGAAGACCGTAACGAACAGGCCT
TTTTACCGTTTTATGGCTCGAAAAGCGTTTATCAGAATCAATCCGAAACCGCCTATTACATGTTGCGGCG
GCAAAAACGTATATTGTCATCCAAACAACGCCGCAAGGGCATGCGATCCAGCTATATCGGCAGCGAATGT
TTTATTTCCATAGTCGATACCGAACAAGCGCCTTATTCGCCGCAAATCAATCAATTGGGTTTGGAAACAC
TTTGTACCAACCGTGACTTGCCGATGGTGATGCCGGTAGGTTTGGGCGATACCGATTTTAGTCTGCAAAT
CAGCGCGCCGGTTAAGTCGATTCGCTGTATTTCCGGCCCCACCCGGCCTTTACCGGCGGCGTATGCCGGC
GAGAGTGTTTGGAAACTTATAAACCATCTCTCGTTGAATTACCTATCGCTGATCGACAGCGATCCTAAGC
AAGGGGCTGCGGCCTTGCGCGAATTATTAAGTCTGTATGCCGAAAATCGCGAGCCGACTATCAAAAAGCA
AATCGAAGGGGTTATCTCCGTTAATGCCAAGAATGTGGTCAGGCGCATCGATTCCAAAGGGCCCATGGTA
TTTGGACGCGGTCTGGAGATTACGGTGTTGTTGGATGAATCTGCATTTGAGGGGGGCGGCTATTTCATGA
TGGGTACGGTTTTGGATCAGTTTTTTACCCGCTACGTATCCATTAATTCCTTTATCGAAACCGTCATCCG
TACCACGGATCGCGGAGAGGTGGCACGATGGCCGACCAGAATCGGACGCCGGCACACGTTTTAA