SecReT6
Protein ID: 333982585
SecReT6 ID443
T6SS typei3
Gene symbol-
Locus tagMetme_0857
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]922700..923764 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDG0A6J4
KEGG IDmmt:Metme_0857
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.20E-106, Aligned region: 18..333
Protein Sequence: 354 a.a.     [Download]
>gi|333982585|ref|YP_004511795.1| unnamed protein product [Methylomonas methanica MC09]
MADQNRTPAHVLIDELEQAAYRFDFFETLRWVEALNVDKPRLGTAVKLSEDAVRLSQEPELQFPASTLAS
CHVGGSGAPRLAVNFLGLFGPNGPLPLHLTEYARERLRNHHDPTMARFADIFHHRMISLFYRAWANPRPT
VSYDRPHADRFGFYVGSLLGLGGEAFRHRDALDDRAKFYYAGHFSAQTKSPDSLQAIIADILSIQVRIEE
FVGEWMEIQTSDHSRLGYTPELATLGQSTLLGAFVWGCQHKFRIVLGPLKLAQYLALLPGAAGLAKLAAT
VRNFLGDELVWDAQLILHKNEVPSELSLGVPAKAGPSSMNGEARLGWSMWLGPRPGPHDADDLTLNPFFA
ASKA
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|333981747|ref|NC_015572.1|:922700-923764 Methylomonas methanica MC09 chromosome, complete genome
ATGGCCGACCAGAATCGGACGCCGGCACACGTTTTAATCGACGAGCTGGAGCAGGCCGCGTACCGTTTCG
ATTTTTTTGAAACGCTACGCTGGGTCGAAGCGCTAAACGTCGATAAGCCCAGGTTGGGGACTGCTGTTAA
GCTTAGCGAAGATGCGGTTCGCCTGTCTCAAGAGCCCGAGTTGCAATTTCCGGCCTCGACATTAGCCTCT
TGTCATGTGGGGGGCTCGGGAGCTCCCCGATTAGCCGTCAATTTTTTGGGATTGTTCGGCCCCAATGGTC
CCTTACCCTTGCATTTGACCGAATATGCCAGGGAGCGTCTAAGGAATCATCACGATCCGACCATGGCGCG
CTTCGCCGATATTTTCCATCACCGCATGATCAGTTTGTTTTACCGGGCCTGGGCCAACCCCAGGCCAACG
GTCAGCTACGATAGGCCGCATGCGGACCGGTTTGGTTTTTATGTGGGTTCGTTGCTGGGCTTGGGGGGTG
AAGCGTTTCGGCATCGGGATGCCTTGGACGACAGGGCCAAGTTTTATTATGCCGGACATTTTTCCGCGCA
AACTAAATCGCCGGACAGCTTGCAGGCCATTATTGCCGACATTTTATCGATCCAGGTCCGCATAGAAGAG
TTTGTCGGCGAATGGATGGAGATTCAGACCAGCGATCATAGTCGTCTGGGCTATACGCCGGAGTTAGCCA
CCTTGGGACAATCGACTTTATTGGGGGCTTTTGTCTGGGGCTGTCAGCATAAATTCAGAATCGTGCTGGG
GCCGTTGAAACTGGCGCAATATCTGGCCTTGTTGCCGGGCGCCGCGGGTTTGGCCAAATTAGCCGCTACC
GTGCGCAATTTTTTGGGGGACGAATTGGTTTGGGATGCCCAGCTGATTCTGCACAAAAATGAAGTGCCGT
CGGAATTGAGTTTGGGCGTGCCCGCCAAAGCTGGTCCGTCCAGTATGAACGGTGAAGCCCGATTGGGCTG
GAGTATGTGGCTGGGGCCGCGGCCTGGCCCGCATGACGCCGATGATTTAACCCTCAATCCATTCTTTGCC
GCGAGCAAAGCATAA