SecReT6
Protein ID: 333982586
SecReT6 ID443
T6SS typei3
Gene symbol-
Locus tagMetme_0858
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]923804..926524 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDG0A6J5
KEGG IDmmt:Metme_0858
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.60E-38, Aligned region: 638..805
AAA [PF00004], Evalue: 2.50E-18, Aligned region: 234..368
AAA [PF00004], Evalue: 2.50E-18, Aligned region: 383..400
AAA [PF00004], Evalue: 2.50E-18, Aligned region: 644..728
ClpB_D2-small [PF10431], Evalue: 2.00E-15, Aligned region: 811..887
AAA_16 [PF13191], Evalue: 3.00E-13, Aligned region: 35..76
AAA_16 [PF13191], Evalue: 3.00E-13, Aligned region: 211..250
AAA_16 [PF13191], Evalue: 3.00E-13, Aligned region: 278..313
AAA_16 [PF13191], Evalue: 3.00E-13, Aligned region: 549..551
AAA_16 [PF13191], Evalue: 3.00E-13, Aligned region: 632..688
AAA_5 [PF07728], Evalue: 5.00E-12, Aligned region: 234..254
AAA_5 [PF07728], Evalue: 5.00E-12, Aligned region: 356..364
AAA_5 [PF07728], Evalue: 5.00E-12, Aligned region: 643..759
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 233..315
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 377..400
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 641..674
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 705..726
Sigma54_activat [PF00158], Evalue: 2.40E-06, Aligned region: 213..248
Sigma54_activat [PF00158], Evalue: 2.40E-06, Aligned region: 643..758
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 234..380
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 644..670
AAA_14 [PF13173], Evalue: 1.30E-05, Aligned region: 234..335
AAA_14 [PF13173], Evalue: 1.30E-05, Aligned region: 380..400
AAA_14 [PF13173], Evalue: 1.30E-05, Aligned region: 642..742
AAA_25 [PF13481], Evalue: 2.60E-05, Aligned region: 229..311
AAA_25 [PF13481], Evalue: 2.60E-05, Aligned region: 535..555
AAA_25 [PF13481], Evalue: 2.60E-05, Aligned region: 640..668
Arch_ATPase [PF01637], Evalue: 3.20E-05, Aligned region: 212..249
Arch_ATPase [PF01637], Evalue: 3.20E-05, Aligned region: 286..318
Arch_ATPase [PF01637], Evalue: 3.20E-05, Aligned region: 375..408
Arch_ATPase [PF01637], Evalue: 3.20E-05, Aligned region: 643..687
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 234..250
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 638..683
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 216..256
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 643..666
AAA_19 [PF13245], Evalue: 0.00027, Aligned region: 234..251
AAA_19 [PF13245], Evalue: 0.00027, Aligned region: 641..666
AAA_17 [PF13207], Evalue: 0.00033, Aligned region: 234..248
AAA_17 [PF13207], Evalue: 0.00033, Aligned region: 643..681
AAA_18 [PF13238], Evalue: 0.00038, Aligned region: 234..250
AAA_18 [PF13238], Evalue: 0.00038, Aligned region: 645..673
AAA_29 [PF13555], Evalue: 0.0015, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.0015, Aligned region: 641..668
Torsin [PF06309], Evalue: 0.0035, Aligned region: 600..666
T2SE [PF00437], Evalue: 0.0056, Aligned region: 207..249
T2SE [PF00437], Evalue: 0.0056, Aligned region: 637..720
Protein Sequence: 906 a.a.     [Download]
>gi|333982586|ref|YP_004511796.1| unnamed protein product [Methylomonas methanica MC09]
MAEISRVKLFGKLNRVCYKAIEGATVFCKLRGNPYVELVHWLNQLLQLPDSDLHRIIKQYSLDGSRLAKD
VTDALERLPRGSTAISDFSPHIEESVERGWVYGTLMFGESQVRTGYLLVGLVKTKSLRNELLGISKEFEK
IKPDSLSDELAQIVSGSPEDGLAATDGFQSGATPGEASGAMAPAAMGKQEALKQFTVDLTEQARTGKIDP
IVGRDEEIRQLIDILMRRRQNNPILTGEAGVGKTAVVEGFALKIVAGDVPPSLREVSLRTLDVGLLQAGA
SMKGEFENRLRQVIEEVQSSPKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEY
KKHIEKDPALTRRFQVVQVLEPSEEKAIRMMRGVVSVQEKHHQVLILDEALEAAVKLSHRYIPARQLPDK
AVSLLDTACARVGISQHAVPPAVDDCRKRIDALETELAIIGREKTVGIEVVGREQEATEKLEAEKVRLAE
LETRWETEKGLVEKILGLRAKLRAAGHAVDEATKPTDSSTADAAEQPASETAEDKDALLAELRALQTELH
AFQGESPLILPTVDHQAVAAVVQDWTGIPVGRMVKNEIETVLKLADNLEQRIIGQRHALEMIARRIQTSR
AGLDNPNKPIGVFMLAGTSGVGKTETALALAEALYGGEQNVITINMSEYQEAHTVSTLKGAPPGYVGYGE
GGVLTEAVRRRPYSVVLLDEVEKAHPDVHEIFFQVFDKGWMEDGEGRVIDFKNTLILLTTNAGTDLIAGL
CSDPELMPDPEGISKALREPLLKVFPPALLGRLVVIPYYPLNDEMIGAIARLQLGRIKKRIAESHKVPFS
YDDEVVKLIASRCTELESGGRMIDAILTNTVLPKISEEFLVRMVEGKPIERVHVTVQDGEFGYGFE
 
Nucleotide Sequence: 2721 bp     [Download]
>gi|333981747|ref|NC_015572.1|:923804-926524 Methylomonas methanica MC09 chromosome, complete genome
ATGGCAGAAATCAGCCGAGTCAAACTGTTTGGAAAATTAAACCGGGTCTGCTACAAGGCAATCGAAGGGG
CGACCGTGTTTTGCAAACTCAGGGGAAATCCGTATGTTGAGTTGGTGCATTGGTTAAATCAACTGTTGCA
ATTGCCCGATTCTGATTTGCACCGCATCATCAAGCAATACAGTCTGGACGGTTCCCGCTTGGCCAAGGAT
GTGACCGATGCGCTGGAACGCTTGCCGCGCGGTTCCACCGCTATTTCCGATTTCTCGCCGCATATCGAGG
AATCGGTGGAACGAGGCTGGGTTTACGGTACCTTGATGTTTGGCGAAAGCCAAGTGCGTACCGGCTACTT
ATTGGTGGGCTTGGTCAAAACCAAATCGTTGCGCAATGAACTGCTGGGTATTTCCAAGGAATTTGAAAAG
ATCAAACCCGACTCGTTGTCGGACGAATTGGCGCAGATTGTCTCCGGTTCGCCTGAAGACGGCTTGGCGG
CAACAGACGGTTTTCAATCCGGCGCCACGCCCGGCGAAGCCAGCGGCGCCATGGCGCCTGCGGCCATGGG
TAAACAGGAAGCCCTGAAACAATTCACCGTCGATCTGACCGAACAAGCCAGAACCGGCAAAATCGATCCC
ATCGTCGGCCGCGATGAAGAAATACGCCAACTGATCGATATTCTGATGCGCCGCCGTCAAAACAACCCGA
TACTCACCGGGGAAGCCGGGGTTGGTAAAACCGCCGTGGTGGAAGGCTTTGCCTTAAAAATTGTGGCCGG
CGATGTGCCGCCGTCGCTGCGGGAAGTCAGTTTGCGCACACTGGACGTCGGTTTGTTGCAAGCCGGGGCC
AGCATGAAGGGTGAGTTCGAGAATCGCTTGCGGCAAGTGATTGAAGAAGTGCAATCGTCACCGAAACCGA
TCATTCTATTTATCGACGAAGCGCATACCCTGGTCGGTGCCGGCGGCGCTGCAGGTACCGGCGACGCCGC
CAATTTATTGAAACCGGCCTTGGCGCGCGGCACACTCAGAACCGTTGCCGCGACCACTTGGGCCGAATAC
AAAAAACATATCGAAAAAGATCCGGCCCTGACGCGCCGTTTTCAAGTTGTGCAGGTGCTGGAGCCTAGCG
AAGAAAAAGCCATCCGTATGATGCGCGGGGTAGTGTCGGTACAGGAAAAACACCATCAGGTATTGATTCT
GGACGAAGCATTGGAAGCGGCTGTAAAACTGTCGCATCGCTATATTCCAGCCAGACAATTACCGGATAAA
GCCGTCAGCTTGCTGGATACAGCCTGCGCGCGGGTAGGCATCAGCCAGCATGCCGTGCCGCCGGCCGTAG
ACGATTGCCGCAAACGCATCGATGCTCTGGAGACCGAGCTGGCCATCATCGGTAGGGAAAAAACCGTGGG
GATCGAAGTAGTCGGCCGCGAACAGGAAGCCACCGAAAAGCTTGAAGCCGAAAAAGTTCGCCTGGCGGAA
CTGGAAACCCGTTGGGAAACCGAAAAAGGTTTGGTAGAGAAAATTCTGGGATTACGCGCCAAGCTCAGAG
CTGCGGGGCATGCCGTCGACGAAGCAACCAAGCCAACCGATTCTTCGACTGCGGATGCGGCCGAGCAACC
CGCGAGTGAGACGGCAGAAGATAAGGACGCTTTGCTCGCCGAACTCAGGGCATTACAAACTGAACTGCAT
GCGTTCCAGGGCGAATCGCCGTTGATTTTACCGACCGTGGATCATCAGGCCGTCGCGGCGGTAGTGCAGG
ACTGGACCGGTATTCCGGTCGGCCGCATGGTGAAAAACGAAATCGAAACCGTGCTGAAACTGGCCGACAA
TCTGGAACAGCGTATCATTGGCCAACGTCATGCCCTGGAAATGATCGCCCGTCGAATTCAAACTTCCCGC
GCGGGGCTCGACAACCCCAACAAACCGATCGGCGTGTTCATGCTGGCCGGTACGTCCGGGGTGGGTAAAA
CCGAAACTGCCTTGGCATTGGCCGAAGCCCTATACGGCGGTGAACAAAACGTTATCACCATCAATATGAG
CGAGTATCAGGAAGCGCATACCGTTTCCACCTTGAAAGGCGCGCCTCCAGGGTATGTCGGCTACGGCGAA
GGCGGGGTGCTGACAGAAGCCGTGCGTCGTCGTCCCTATAGCGTAGTGCTGCTGGACGAGGTGGAAAAAG
CCCATCCGGACGTGCATGAGATATTCTTTCAGGTGTTCGACAAAGGCTGGATGGAAGACGGCGAAGGCCG
GGTCATCGATTTTAAAAATACTCTGATTTTGTTGACCACCAACGCCGGTACCGATTTGATAGCCGGCCTT
TGCAGCGACCCTGAATTGATGCCGGATCCCGAAGGTATTTCCAAAGCCTTGCGGGAACCGTTACTCAAAG
TGTTCCCGCCTGCATTGCTGGGCCGTTTGGTGGTGATTCCTTATTATCCGCTCAACGACGAAATGATAGG
CGCCATCGCCCGTCTGCAGCTGGGTCGTATCAAAAAACGCATTGCCGAAAGCCACAAAGTGCCGTTCAGC
TACGACGACGAAGTCGTCAAACTTATCGCCAGCCGTTGCACCGAATTGGAAAGCGGCGGCCGCATGATAG
ATGCGATTTTGACCAATACCGTGTTGCCGAAAATCAGCGAGGAGTTTTTGGTCCGCATGGTGGAAGGCAA
GCCGATCGAGCGGGTGCATGTCACCGTGCAGGATGGGGAGTTTGGATATGGGTTCGAGTGA