SecReT6
Protein ID: 335055499
SecReT6 ID124
T6SS typei2
Gene symbol-
Locus tagRmet_0623
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T6SS(s) in this replicon]
Location [Strand]683645..684205 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ1LQR7
KEGG IDrme:Rmet_0623
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.60E-24, Aligned region: 5..112
Protein Sequence: 186 a.a.     [Download]
>gi|335055499|ref|YP_582778.2| unnamed protein product [Cupriavidus metallidurans CH34]
MTPQHFQQQALWEQHTNEHTARIASPEPWGTVRVGIDSQALSIHRLMVNALAIRLPDGTVIDTDTADHTP
PARDLADVPSNVDSVVVLIGLPLIDTQGGNCAWGRQGRDKCRTARTGPALRIRDTRRLRDLPDRPADAHA
ARAIRTRSGVRATVPLPVSERPAHRAHAPTLGNPGCQEREPCCAQA
 
Nucleotide Sequence: 561 bp     [Download]
>gi|94308945|ref|NC_007973.1|:c684205-683645 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGACCCCGCAGCATTTCCAGCAGCAAGCGCTGTGGGAACAGCACACCAACGAGCACACTGCGCGCATCG
CCAGCCCCGAGCCGTGGGGTACGGTGCGGGTGGGGATCGATTCGCAGGCGCTGTCCATCCATCGATTGAT
GGTCAATGCGCTGGCGATCCGCCTGCCAGATGGCACGGTGATCGACACAGACACTGCGGACCATACCCCA
CCCGCACGCGATCTCGCCGACGTGCCGTCCAACGTCGACAGCGTCGTGGTGCTGATTGGCCTGCCTCTGA
TCGATACGCAAGGCGGCAACTGCGCATGGGGAAGGCAAGGAAGAGATAAGTGTCGAACTGCACGCACTGG
CCCTGCTCTTCGAATTCGAGACACACGGCGACTACGTGACCTGCCCGATCGCCCGGCTGATGCGCACGCC
GCAAGGGCGATTCGAACTCGATCCGGTGTTCGTGCCACCGTGCCTCTTCCTGTCAGCGAACGACCGGCTC
ACCGAGCGCATGCGCCGACTCTCGGAAATCCTGGCTGCCAAGAGCGCGAGCCTTGCTGTGCGCAGGCGTG
A