SecReT6
Protein ID: 33595408
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0713
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]754606..755655 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ7W1H6
KEGG IDbpa:BPP0713
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-23, Aligned region: 59..118
ImpA-rel_N [PF06812], Evalue: 1.20E-23, Aligned region: 228..244
Protein Sequence: 349 a.a.     [Download]
>gi|33595408|ref|NP_883051.1| unnamed protein product [Bordetella parapertussis 12822]
MPRMTTNMEFADLLKTLTPSLPCGEDLEYDADFLQLQQAAVGRSEQQFGATIIPAQAPDWRAVERLALGL
LERTRDLRIIAYLTRAWTEMRGLPGYAEGVTLAAGTLEQYWDAVHPMLASGGEEDPMPRVNALASLGDPQ
GCVRGMRSACLLDDVHGRLSLRDAEALLDGGRSEADYPGGRTRLIENLRQARLRRDDAALAVGAAAGALR
RIQQQATQRLGSAWCPDYAQALRALDALLRTWSDLDETAAAPAAAMPAEAHHAAPAPEPQPAPASWHDAR
IATREDAMAMLAKVSAYFETHEPSHPAPYLIRRVQQLIPLDFHDILRNLAPQGLAQFEAWTAREAASQS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|33594723|ref|NC_002928.3|:754606-755655 Bordetella parapertussis 12822 chromosome, complete genome
TTGCCGCGCATGACGACGAACATGGAATTTGCCGACCTGTTGAAGACGCTGACGCCCAGCCTGCCCTGCG
GGGAGGACCTGGAGTACGACGCTGATTTCCTGCAGTTGCAGCAGGCCGCCGTGGGCCGCAGCGAGCAGCA
GTTCGGCGCCACCATCATCCCCGCGCAGGCGCCCGACTGGCGCGCGGTGGAGCGGCTGGCGCTGGGGCTG
CTGGAGCGCACGCGCGACCTGCGCATCATCGCCTACCTGACGCGCGCCTGGACCGAGATGCGCGGCCTGC
CCGGCTATGCCGAGGGCGTGACGCTGGCCGCCGGCACGCTGGAGCAATACTGGGACGCGGTGCATCCGAT
GCTGGCCAGCGGCGGCGAGGAAGACCCGATGCCGCGCGTCAATGCGCTGGCCTCGCTGGGCGACCCGCAG
GGCTGCGTGCGCGGCATGCGCTCGGCCTGCCTGCTCGACGATGTGCATGGCCGCCTGTCGCTGCGCGATG
CCGAGGCCCTGCTCGACGGCGGCAGGAGCGAGGCCGACTATCCGGGCGGGCGCACGCGCCTGATCGAGAA
CCTGCGCCAGGCGCGCCTGCGGCGCGACGACGCGGCGCTGGCCGTGGGCGCGGCCGCCGGCGCGCTGCGC
CGCATCCAGCAGCAGGCCACCCAGCGCCTGGGCTCGGCCTGGTGTCCGGACTATGCGCAGGCGCTGCGCG
CGCTGGATGCCTTGCTGCGCACCTGGAGCGACCTGGACGAAACCGCGGCGGCGCCCGCCGCGGCCATGCC
GGCCGAAGCGCATCACGCGGCCCCGGCGCCTGAACCCCAACCCGCGCCCGCCAGCTGGCACGACGCGCGC
ATCGCCACGCGCGAAGACGCGATGGCCATGCTGGCCAAGGTCAGCGCCTACTTCGAAACCCATGAGCCCA
GCCATCCGGCGCCCTATCTGATCCGCCGGGTGCAGCAGCTCATTCCCCTGGATTTCCACGACATCCTGCG
CAACCTGGCCCCGCAGGGCCTGGCGCAGTTCGAGGCGTGGACCGCGCGCGAGGCCGCCAGCCAGTCCTAG