SecReT6
Protein ID: 33595409
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0714
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]755698..756261 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ7W1H5
KEGG IDbpa:BPP0714
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.80E-57, Aligned region: 13..165
Protein Sequence: 187 a.a.     [Download]
>gi|33595409|ref|NP_883052.1| unnamed protein product [Bordetella parapertussis 12822]
MATTLKGSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKSNTPQPEVGERKFLDVDID
NFDERMKSVAPRAAFQVANTLTGAGHLNVDITFESIDDFSPATVARKVGALNEMLEARTQLANLLTYMDG
KTGAEELIGQVLQNPALLGALAAAPKPADAGPADADAESAQPGPQAR
 
Nucleotide Sequence: 564 bp     [Download]
>gi|33594723|ref|NC_002928.3|:755698-756261 Bordetella parapertussis 12822 chromosome, complete genome
ATGGCAACCACGCTCAAAGGCAGCGGCCAGAAATTCATCGCCAGGAATCGCGCGCCGCGCGTGCAGATCG
AGTACGACGTGGAGATCTACGGCGCCGAGCGCAAGATCCAGCTGCCCTTCGTCATGGGCGTGCTGGCCGA
CCTGGCCGGCAAGTCGAACACGCCGCAGCCCGAAGTGGGCGAGCGCAAGTTCCTCGACGTCGATATCGAC
AATTTCGACGAGCGCATGAAGTCGGTCGCCCCGCGGGCCGCGTTCCAGGTGGCCAATACGCTGACCGGCG
CCGGCCATCTGAACGTGGACATCACCTTCGAGAGCATCGACGATTTTTCCCCGGCCACCGTGGCGCGCAA
GGTGGGCGCGCTCAACGAGATGCTGGAGGCCCGCACGCAGCTGGCCAACCTGCTGACCTACATGGACGGC
AAGACCGGCGCCGAGGAGCTGATCGGCCAGGTGCTGCAGAACCCGGCCCTGCTGGGCGCGCTGGCGGCCG
CGCCCAAGCCCGCCGACGCCGGGCCGGCCGATGCCGACGCCGAGAGCGCGCAGCCCGGCCCGCAAGCCCG
ATAA