SecReT6
Protein ID: 33595410
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0715
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]756283..757785 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ7W1H4
KEGG IDbpa:BPP0715
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.60E-195, Aligned region: 67..493
Protein Sequence: 500 a.a.     [Download]
>gi|33595410|ref|NP_883053.1| unnamed protein product [Bordetella parapertussis 12822]
MTAVARRERAQAESSLAADDLSALLKKEFKPKTEQAREAVEHAVRTLAHQALENSGLGLSSDAYRTIQAI
IAEIDRKLSEQINLVMHHPDFQQLEGAWRGLHYLVTNTETDELLKIRFMCLSKNELGRTLKRYKGVGWDQ
SPIFKRVYEEEYGQFGGEPIGCLVGDYSFDHSPPDVELLGEIARISAAAHCPFIAGASPNVMQMDSWQEL
SNPRDLTKIFTNTEYVAWRSLRELEDARYVGLAMPRFLARLPYGARTNPVDEFDFEEETDGANHDRYTWA
NSAYAMAANINRSFKLYGWCTSIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLVHRKNSDFAAFIGAQSLQRPQEYHDADASANAKLAARLPYLFACCRFAHYLKCIVRDKIGSFRERSD
MERWLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVTEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVS
KLPSLKQNEG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|33594723|ref|NC_002928.3|:756283-757785 Bordetella parapertussis 12822 chromosome, complete genome
ATGACCGCAGTGGCCCGGCGCGAACGCGCGCAAGCCGAATCCAGCCTGGCGGCGGACGACCTGTCCGCCC
TGCTGAAGAAAGAGTTCAAGCCCAAGACCGAGCAGGCGCGCGAGGCCGTGGAGCACGCGGTGCGCACGCT
GGCGCACCAGGCCCTGGAAAACAGCGGGCTGGGCCTGTCCTCGGACGCCTACCGGACCATCCAGGCCATC
ATCGCCGAGATCGACCGCAAGCTGTCCGAGCAGATCAACCTGGTGATGCACCATCCCGACTTCCAGCAGC
TCGAAGGCGCCTGGCGCGGACTGCACTACCTGGTCACCAACACCGAGACCGACGAGCTGCTGAAGATCCG
CTTCATGTGCCTGTCCAAGAACGAGCTGGGGCGTACGCTCAAGCGCTACAAGGGGGTCGGCTGGGACCAG
AGCCCGATCTTCAAGCGCGTCTACGAGGAAGAGTACGGCCAGTTCGGCGGCGAGCCCATCGGCTGCCTGG
TGGGCGACTACAGCTTCGACCACAGTCCTCCCGATGTCGAGCTGCTGGGCGAGATCGCCCGCATCAGCGC
CGCCGCCCACTGCCCCTTCATCGCCGGCGCCTCGCCCAACGTGATGCAGATGGATTCCTGGCAGGAGCTT
TCCAACCCGCGCGACCTGACCAAGATCTTCACCAATACCGAGTACGTCGCCTGGCGCAGCCTGCGCGAAT
TGGAAGACGCGCGCTATGTCGGCCTGGCCATGCCGCGCTTCCTGGCGCGCCTGCCCTACGGCGCGCGCAC
CAATCCGGTCGATGAGTTCGATTTCGAGGAAGAAACCGACGGCGCCAACCACGACCGGTACACCTGGGCC
AATTCGGCCTACGCGATGGCCGCCAACATCAACCGTTCGTTCAAGCTGTACGGCTGGTGCACCTCGATCC
GCGGCGTGGAATCCGGCGGCGCGGTCGAGAACCTGCCATGCCACACCTTCCCGACCGACGACGGCGGAGT
GGACATGAAGTGTCCCACCGAGATCGCCATCAGCGACCGGCGCGAGGCCGAGCTGGCCAAGAACGGCTTC
ATGCCGCTGGTGCATCGCAAGAACTCCGATTTCGCCGCCTTCATCGGCGCGCAGTCGCTGCAGCGTCCGC
AGGAATACCACGACGCCGACGCCAGCGCCAACGCCAAGCTGGCCGCGCGCCTGCCCTACCTGTTCGCCTG
CTGCCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTTCGCGAGCGCAGCGAC
ATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTCGACGGCGACCCGGCCAACTCTTCGCAGGAAA
CCAAGGCGCGCAAGCCGCTGGCCGCCGCCGAGGTGCAGGTCACCGAGATCGAGGACAACCCGGGCTATTA
CGCCGCCAAGTTTTTCCTGCGGCCGCACTATCAGCTCGAGGGGCTGACGGTGTCGCTGCGGCTCGTGTCC
AAGCTGCCTTCGCTCAAGCAGAACGAAGGCTGA