SecReT6
Protein ID: 33595411
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0716
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]757843..758328 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ7W1H3
KEGG IDbpa:BPP0716
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.40E-36, Aligned region: 6..135
Protein Sequence: 161 a.a.     [Download]
>gi|33595411|ref|NP_883054.1| unnamed protein product [Bordetella parapertussis 12822]
MAVDMFMKIEGANGESKDANHKDWTDIVSFSWGATQPASLATGGGQGVGKASFNDLHVVARIDKAAPAVM
KHCASGKHLGKIELSVCKAGGAQVEYSKVTLEDVLVTSVQIAADNGSEAVLVNYAFQAAKVRQQYWEQTE
SGGKGAESLVAWDIKQNKEIG
 
Nucleotide Sequence: 486 bp     [Download]
>gi|33594723|ref|NC_002928.3|:757843-758328 Bordetella parapertussis 12822 chromosome, complete genome
GTGGCTGTTGATATGTTCATGAAGATCGAAGGCGCCAATGGCGAATCCAAGGACGCCAACCACAAGGACT
GGACCGATATCGTGTCCTTTTCGTGGGGCGCCACCCAGCCGGCCAGCCTGGCGACCGGCGGCGGCCAGGG
CGTGGGCAAGGCCAGCTTCAACGATCTGCACGTGGTGGCCCGCATCGACAAGGCGGCGCCGGCGGTCATG
AAGCACTGCGCCAGCGGCAAGCACCTGGGCAAGATCGAACTGTCGGTGTGCAAGGCGGGCGGCGCGCAGG
TCGAGTACAGCAAGGTCACGCTGGAAGACGTGCTGGTCACCTCGGTGCAGATCGCCGCGGACAACGGTTC
GGAGGCGGTGCTGGTCAACTATGCCTTCCAGGCCGCCAAGGTGCGCCAGCAGTACTGGGAGCAGACCGAG
TCGGGCGGCAAGGGCGCCGAGAGCCTGGTCGCGTGGGACATCAAGCAGAACAAGGAAATCGGCTGA