SecReT6
Protein ID: 33595412
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0717
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]758378..759187 [+]
Producthypothetical protein
NoteTagJ
UniProt IDQ7W1H2
KEGG IDbpa:BPP0717
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.00E-44, Aligned region: 147..264
Protein Sequence: 269 a.a.     [Download]
>gi|33595412|ref|NP_883055.1| unnamed protein product [Bordetella parapertussis 12822]
MQTSVLAMPPRDGGLAGQAAAVQARIRRAPADADLRAQLFQLAAVQGDWRRAAEQLQLCARLNPLAQPMA
NLYLAAIHGELRREAVLAGQAEPGFLAERPCWCEPLLQALRAQASDPERAAMLRAQAFDAAQASAGTLED
AAAGQAGYAWICDGDSRLGPVCELILDGSYAWLPFAQVAAVHLPAPQGLCDLVWARAEIALADGAVVRGL
VPARYPPSAGQDDGLRLGRATCWRPLGQDGYAGEGQKMWLTDAGEFALLDVRALRRQAP
 
Nucleotide Sequence: 810 bp     [Download]
>gi|33594723|ref|NC_002928.3|:758378-759187 Bordetella parapertussis 12822 chromosome, complete genome
ATGCAGACATCCGTGCTTGCGATGCCCCCGCGCGACGGCGGCCTGGCCGGTCAGGCCGCGGCCGTGCAGG
CGCGCATCCGGCGCGCGCCGGCCGACGCCGATTTGCGCGCGCAACTTTTCCAGCTGGCTGCCGTGCAGGG
CGACTGGCGCCGCGCCGCCGAGCAATTGCAACTGTGCGCCCGGCTGAACCCGCTGGCCCAGCCGATGGCC
AATCTCTACCTGGCGGCCATCCATGGCGAGCTGCGGCGCGAAGCCGTGCTGGCGGGCCAGGCCGAACCCG
GCTTCCTGGCCGAGCGGCCCTGCTGGTGCGAGCCGTTGCTGCAGGCGCTGCGCGCCCAGGCGAGCGACCC
CGAGCGGGCCGCCATGCTGCGCGCCCAGGCGTTCGATGCGGCGCAGGCCAGCGCCGGCACGCTGGAGGAC
GCGGCCGCCGGCCAGGCCGGCTATGCCTGGATCTGCGACGGCGACAGCCGCCTGGGGCCGGTCTGCGAAC
TGATTCTCGACGGCAGCTATGCGTGGCTGCCGTTCGCGCAGGTGGCCGCCGTGCATCTGCCGGCCCCGCA
AGGGCTGTGCGATCTCGTCTGGGCGCGCGCCGAAATCGCCCTGGCCGACGGCGCGGTCGTGCGCGGCCTG
GTTCCGGCGCGCTACCCGCCGTCGGCCGGGCAGGATGACGGCCTGAGGCTGGGCCGGGCCACGTGCTGGC
GGCCGCTGGGCCAGGACGGCTACGCCGGCGAGGGCCAGAAGATGTGGCTGACCGACGCGGGCGAGTTCGC
GCTGCTGGACGTGCGCGCCCTGCGCCGGCAGGCGCCATGA