SecReT6
Protein ID: 33595413
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0718
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]759184..759702 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ7W1H1
KEGG IDbpa:BPP0718
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-20, Aligned region: 39..150
Protein Sequence: 172 a.a.     [Download]
>gi|33595413|ref|NP_883056.1| unnamed protein product [Bordetella parapertussis 12822]
MRIADERVARDRLQPSLLDRLVDDEPWRRSEAPEAALLTHAGLRAAVLRDLRWLLNTVNLASSQDLAPYR
HVPASSVNFGVRAMAGRRMSEIDWVDVETSIRDAIAAFEPRILESSVEVRCVSDTRTLEHHNVLSLEIRG
MLWCVPHPREFLFRTDIDLESGHMDLRDLGGA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|33594723|ref|NC_002928.3|:759184-759702 Bordetella parapertussis 12822 chromosome, complete genome
ATGAGAATCGCCGACGAACGGGTGGCGCGCGACCGCCTGCAGCCGTCGCTGCTCGATCGCCTGGTCGATG
ACGAGCCATGGCGCCGCAGCGAGGCGCCCGAAGCGGCGCTGTTGACGCACGCCGGGCTGCGCGCCGCGGT
ACTGCGCGACCTGCGCTGGCTGCTCAACACGGTCAACCTCGCCTCGTCGCAGGATCTGGCGCCGTACCGG
CACGTGCCCGCCTCCAGCGTCAATTTCGGCGTGCGCGCCATGGCCGGACGCCGCATGTCGGAGATCGACT
GGGTCGATGTCGAGACGTCGATCCGCGACGCCATCGCGGCGTTCGAGCCGCGCATCCTGGAATCCTCGGT
CGAGGTGCGCTGCGTCAGCGACACCCGCACGCTCGAGCACCACAATGTGCTCAGCCTGGAAATACGCGGC
ATGCTGTGGTGCGTGCCGCACCCGCGCGAGTTCCTGTTCCGCACCGATATCGACCTGGAAAGCGGGCACA
TGGACCTGCGCGACCTGGGAGGGGCGTGA