SecReT6
Protein ID: 33595414
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0719
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]759702..761615 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ7W1H0
KEGG IDbpa:BPP0719
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.00E-211, Aligned region: 5..636
Protein Sequence: 637 a.a.     [Download]
>gi|33595414|ref|NP_883057.1| unnamed protein product [Bordetella parapertussis 12822]
MDARLLDYYNRELVYMRELGAEFARQHPKVAGRLGMHGTEVADPYVERLLEGFSFLAARIHLKMDAEFPR
FTQRLLEVVHPHYLAPTPAMAVAQFSPSMNEGTLAGGFTLPRGTVLRGGLARGEQTPCEFMTGHALRLWP
LRVTAAELTGAPTDLPLARLGLGGREAGVASALRLRLEVCGGVSLEELDLDQLVFYLNGSDAPMQRLLEL
IMCHTVAVLGHDSERPVSWINRLPADAVRHEGFADDQALLPTDTRVFQGYRLLQEYFAFARRYLFFSLNG
LKQGLCTRRAAPAAAAGPAGTRRFDLTLLLSAAAPELEGAISAGNLALHCAPIVNLFPRRADRVAVTPRH
HEYHVVVDRTRPLDFEVYSLTRVLGHMSAQRPEQEFRPFYGSFGADADDYGAYYSLRREPRLASDSARRH
GTRTSYTGSEVYLSLVDRHEAPFADTLRHLGIDALCTNRDLALLLPLGGASDFSLRVSAPVGAIKVLHGP
SRPAAAMADHGTAWQLISHLGLHYHSLTDLDETRGAQTLRELLNLYGNLADPVARKHISGVRHVRVEPMH
HRLPVPGPIVYGRGVRIDLQVDETAFSGISPYLCGAVLEQFFARHVSINMMSALTLSTPQRGAVASWRPR
MGRRPAV
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|33594723|ref|NC_002928.3|:759702-761615 Bordetella parapertussis 12822 chromosome, complete genome
ATGGACGCGCGCCTGCTCGACTACTACAACCGCGAGCTGGTCTATATGCGCGAGCTGGGCGCCGAGTTCG
CGCGCCAGCATCCCAAGGTGGCGGGGCGGCTGGGCATGCACGGCACCGAGGTGGCCGACCCGTACGTCGA
GCGCCTGCTCGAAGGCTTCAGCTTCCTGGCCGCGCGCATCCACCTGAAGATGGACGCCGAGTTTCCGCGC
TTCACGCAGCGGCTGCTGGAGGTGGTGCATCCGCACTATCTCGCGCCCACCCCGGCGATGGCGGTGGCGC
AGTTCTCGCCCAGCATGAACGAAGGCACGCTGGCCGGCGGCTTTACCCTGCCGCGCGGCACCGTGCTGCG
CGGCGGCCTGGCGCGTGGCGAACAAACGCCGTGCGAGTTCATGACCGGCCACGCGCTGCGGCTGTGGCCG
CTGCGCGTGACGGCGGCCGAACTCACCGGCGCGCCCACCGACCTGCCGCTGGCCCGCCTGGGCCTGGGCG
GACGCGAGGCCGGAGTGGCCAGCGCGCTGCGCCTGCGGCTGGAAGTCTGCGGCGGCGTCAGCCTGGAAGA
GCTGGACCTGGATCAACTGGTGTTCTACCTCAACGGGTCGGACGCGCCCATGCAGCGCCTGCTGGAGCTG
ATCATGTGCCACACGGTCGCCGTGCTGGGCCACGACAGCGAGCGGCCCGTCTCGTGGATCAACCGGCTGC
CGGCCGACGCGGTGCGCCACGAGGGGTTCGCCGACGACCAGGCGCTGCTGCCCACCGACACGCGGGTCTT
CCAGGGCTATCGGCTGCTGCAGGAGTACTTCGCGTTCGCGCGCCGCTATCTGTTCTTCAGCCTGAACGGC
CTGAAGCAGGGCCTGTGCACGCGGCGCGCGGCGCCGGCCGCGGCGGCTGGCCCGGCCGGCACCCGGCGTT
TCGACCTGACGCTGCTGCTGTCGGCCGCAGCGCCCGAGCTCGAAGGCGCGATCTCGGCCGGGAACCTGGC
GCTGCACTGCGCGCCCATCGTCAACCTGTTTCCGCGCCGCGCCGACCGCGTGGCGGTCACGCCGCGCCAC
CACGAGTACCACGTGGTGGTCGACCGCACCCGGCCGCTGGACTTCGAGGTCTACAGTCTGACGCGGGTGC
TCGGCCATATGTCGGCGCAGCGCCCCGAACAGGAGTTCCGTCCGTTCTACGGCTCGTTCGGCGCGGACGC
CGACGATTACGGCGCCTATTACTCGTTGCGGCGCGAGCCGCGGCTGGCCTCGGACAGCGCGCGCCGCCAT
GGCACGCGCACCAGCTATACCGGCAGCGAAGTCTATCTGTCGCTGGTCGATCGGCACGAGGCGCCGTTTG
CCGATACGCTGCGCCATCTCGGCATCGACGCGCTGTGCACCAACCGCGACCTGGCGCTGCTGCTGCCGCT
GGGCGGCGCCAGCGATTTCAGCCTGCGCGTGTCCGCCCCGGTGGGCGCGATCAAGGTGCTGCATGGGCCG
TCGCGGCCGGCCGCGGCCATGGCCGACCACGGCACGGCATGGCAATTGATCAGCCACCTGGGGCTGCACT
ACCACAGCCTGACCGACCTGGACGAGACGCGCGGCGCGCAGACGCTGCGCGAGCTGCTCAACCTGTACGG
CAACCTGGCCGATCCGGTGGCGCGCAAGCATATCTCGGGCGTGCGCCACGTGCGGGTCGAACCCATGCAC
CACCGCCTGCCCGTGCCCGGCCCCATCGTCTACGGCCGCGGCGTGCGCATCGACCTGCAGGTCGACGAGA
CCGCTTTCTCGGGCATCAGCCCCTACCTGTGCGGCGCGGTGCTGGAGCAGTTCTTCGCGCGCCACGTCTC
CATCAACATGATGTCGGCGCTCACCCTGTCCACGCCGCAGCGCGGCGCCGTGGCGAGCTGGCGGCCCCGC
ATGGGCCGCCGTCCCGCGGTCTAG