SecReT6
Protein ID: 33595416
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0721
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]762312..763406 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ7W1G8
KEGG IDbpa:BPP0721
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-109, Aligned region: 26..328
Protein Sequence: 364 a.a.     [Download]
>gi|33595416|ref|NP_883059.1| unnamed protein product [Bordetella parapertussis 12822]
MDAAARTDRHAAPAVLPPAFWQALAAAPHGHDLFHVLRWIDARAGARAPLGRGASPRHEPVRMRQEPSLA
FAPATLAAARAPGEGAAPELSIYSFGLFGPNGPLPLPLHLTEHARERRQHHGDHSLAAFADLFHHRLILL
FYRAWADAQSTASLDRGQERFSGYVASLLHLGAPSLRRRDSVMDHAKYHMAGHLLRQTRNPEGLCQVLRA
FFGLPVGVDEFVAQWIRLEAGQRLRLGAGGGLGGGAPLGVAVRDAQHKFRIRLGPLDWQDYLAFLPGSAR
ARQLLHWVRLYVGVEFAWEVRPVLRRDAVRSVRLGAAAPLGLASWLGRRPPRLGDAAELLLDYEGRERQA
ARRAQAFHEKEQAA
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|33594723|ref|NC_002928.3|:762312-763406 Bordetella parapertussis 12822 chromosome, complete genome
ATGGACGCAGCGGCCAGGACGGATCGACACGCGGCGCCGGCGGTGCTGCCGCCTGCCTTCTGGCAGGCCC
TGGCGGCGGCGCCGCACGGGCACGACCTGTTTCACGTGCTGCGCTGGATCGACGCGCGCGCCGGCGCGCG
CGCGCCGCTGGGCCGCGGCGCCTCGCCGCGCCACGAACCGGTGCGCATGCGGCAGGAGCCTTCGCTGGCT
TTCGCGCCGGCCACCCTGGCCGCGGCGCGCGCGCCGGGCGAGGGCGCCGCGCCCGAGCTGTCCATCTACA
GCTTCGGCCTGTTCGGTCCCAATGGGCCGCTGCCGCTGCCGCTGCACCTGACCGAGCACGCCCGCGAACG
CCGCCAGCATCACGGCGACCACTCCCTGGCCGCGTTCGCCGACCTGTTCCACCATCGCCTGATCCTGCTG
TTCTACCGCGCCTGGGCCGATGCGCAGTCCACCGCCAGCCTGGACCGCGGCCAGGAGCGCTTCAGCGGCT
ACGTGGCCAGCCTGCTGCACCTGGGCGCGCCGTCGCTGCGCCGGCGCGACAGCGTGATGGACCATGCCAA
GTACCACATGGCCGGCCATCTGCTGCGCCAGACCCGCAACCCGGAAGGCCTGTGCCAGGTGCTGCGCGCC
TTCTTCGGCCTGCCCGTGGGGGTAGACGAGTTCGTGGCGCAGTGGATAAGGTTGGAGGCCGGCCAGCGGC
TGCGGCTGGGGGCGGGCGGCGGGCTGGGCGGCGGCGCGCCCCTGGGCGTGGCCGTGCGCGACGCCCAGCA
CAAGTTCAGGATCCGCCTCGGGCCGCTGGACTGGCAGGACTACCTGGCGTTCCTGCCCGGTTCGGCCCGC
GCGCGCCAGCTGCTGCATTGGGTGCGCCTGTATGTGGGCGTGGAGTTCGCCTGGGAGGTGCGGCCGGTGC
TGCGCCGCGACGCGGTGCGCAGCGTGCGCCTGGGCGCGGCGGCGCCGCTGGGGCTGGCGTCCTGGCTGGG
CCGGCGGCCGCCGCGCCTGGGCGACGCCGCCGAGCTGTTGCTGGACTACGAGGGGCGCGAGCGCCAGGCG
GCGCGGCGCGCGCAAGCGTTTCATGAAAAGGAGCAAGCGGCATGA