SecReT6
Protein ID: 33595419
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0724
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]764327..766900 [+]
ProductATPase
NoteTssH
UniProt IDQ7W1G5
KEGG IDbpa:BPP0724
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-37, Aligned region: 221..300
AAA_2 [PF07724], Evalue: 2.40E-37, Aligned region: 589..755
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 222..353
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 595..678
ClpB_D2-small [PF10431], Evalue: 4.50E-14, Aligned region: 762..836
AAA_5 [PF07728], Evalue: 5.60E-13, Aligned region: 222..249
AAA_5 [PF07728], Evalue: 5.60E-13, Aligned region: 594..704
AAA_16 [PF13191], Evalue: 7.70E-10, Aligned region: 62..72
AAA_16 [PF13191], Evalue: 7.70E-10, Aligned region: 199..244
AAA_16 [PF13191], Evalue: 7.70E-10, Aligned region: 267..301
AAA_16 [PF13191], Evalue: 7.70E-10, Aligned region: 564..639
AAA_22 [PF13401], Evalue: 1.50E-09, Aligned region: 222..302
AAA_22 [PF13401], Evalue: 1.50E-09, Aligned region: 353..388
AAA_22 [PF13401], Evalue: 1.50E-09, Aligned region: 532..553
AAA_22 [PF13401], Evalue: 1.50E-09, Aligned region: 593..617
AAA_22 [PF13401], Evalue: 1.50E-09, Aligned region: 655..678
Sigma54_activat [PF00158], Evalue: 2.10E-08, Aligned region: 208..300
Sigma54_activat [PF00158], Evalue: 2.10E-08, Aligned region: 376..393
Sigma54_activat [PF00158], Evalue: 2.10E-08, Aligned region: 594..694
Clp_N [PF02861], Evalue: 3.20E-07, Aligned region: 26..75
Clp_N [PF02861], Evalue: 3.20E-07, Aligned region: 111..135
AAA_17 [PF13207], Evalue: 1.10E-06, Aligned region: 24..106
AAA_17 [PF13207], Evalue: 1.10E-06, Aligned region: 222..277
AAA_17 [PF13207], Evalue: 1.10E-06, Aligned region: 593..630
IstB_IS21 [PF01695], Evalue: 6.70E-06, Aligned region: 204..244
IstB_IS21 [PF01695], Evalue: 6.70E-06, Aligned region: 594..614
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 220..243
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 412..498
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 585..634
AAA_18 [PF13238], Evalue: 2.90E-05, Aligned region: 222..256
AAA_18 [PF13238], Evalue: 2.90E-05, Aligned region: 595..623
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 222..254
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 594..622
AAA_14 [PF13173], Evalue: 7.70E-05, Aligned region: 222..302
AAA_14 [PF13173], Evalue: 7.70E-05, Aligned region: 593..681
AAA_29 [PF13555], Evalue: 9.20E-05, Aligned region: 214..238
AAA_29 [PF13555], Evalue: 9.20E-05, Aligned region: 592..619
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 221..246
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 371..399
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 448..488
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 592..619
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 201..237
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 274..305
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 593..615
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 659..676
Hpr_kinase_C [PF07475], Evalue: 0.0046, Aligned region: 222..234
Hpr_kinase_C [PF07475], Evalue: 0.0046, Aligned region: 591..613
AAA_25 [PF13481], Evalue: 0.0053, Aligned region: 35..64
AAA_25 [PF13481], Evalue: 0.0053, Aligned region: 217..246
AAA_25 [PF13481], Evalue: 0.0053, Aligned region: 275..314
AAA_25 [PF13481], Evalue: 0.0053, Aligned region: 348..372
AAA_25 [PF13481], Evalue: 0.0053, Aligned region: 491..518
AAA_25 [PF13481], Evalue: 0.0053, Aligned region: 592..620
AAA_25 [PF13481], Evalue: 0.0053, Aligned region: 769..820
RNA_helicase [PF00910], Evalue: 0.0058, Aligned region: 223..243
RNA_helicase [PF00910], Evalue: 0.0058, Aligned region: 595..616
DUF815 [PF05673], Evalue: 0.0064, Aligned region: 214..298
DUF815 [PF05673], Evalue: 0.0064, Aligned region: 589..633
NTPase_1 [PF03266], Evalue: 0.0077, Aligned region: 222..244
NTPase_1 [PF03266], Evalue: 0.0077, Aligned region: 273..299
NTPase_1 [PF03266], Evalue: 0.0077, Aligned region: 594..615
Protein Sequence: 857 a.a.     [Download]
>gi|33595419|ref|NP_883062.1| unnamed protein product [Bordetella parapertussis 12822]
MSDIGRAELFGKLDSLSYRALEDATALCKLRGNPYVELAHWVHAIAHAQDSDLHHIARAFELDLGALQQD
LVRALDQLPRGAGAVSDLSEHVDHVVERAWALASLRYGAARIRSGHLLLALLRDPSLRGVLAGMSGQFAR
VVPDLLLQGLPEMTRGSPEARADAAVADAPPDGGGAAGALARYAVDLTAQARAGRLDPVTGRDDEIRQLI
DVLMRRRQNNPLLTGEAGVGKTAVVEGLALRLARGDVPAPLREVALYLLDIGLLQAGAGVKGEFEQRLRQ
VIDAVQGSERPIVLFIDEIHTLVGAGGAAGTGDAANLLKPALARGQLRTIGATTWAEYKQYIEKDPALTR
RFQAIQVHEPDEAGARRMLRGLAGALQAHHGVLLLDEAVEAAVRLSHRYIPARQLPDKAVALLDTACARV
AVSQQATPAALEDARRRIDALDLELEIAAREARLDAGPAERVAGLREQGQAARWEREAALAGQVFGLREQ
LDAADEQSAPALRAALREAADALARSQGEAPLIHPAVDAAAVVADWTGIPVGRMVRDEAQAVLALADTLE
RRVVGQRHALELIARRIQTARAGLTDPGKPVGVFLLCGPSGVGKTETALALAEALYGGEQNLITINMSEF
QESHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPHSVVLLDEVEKAHADVHEIFFQVFDKGWMEDGEGRYI
DFRNTVILLTANVGADLIASLCADPELAPEPDALAAALRAPLRDVFPAALLGRLAAVPYLPLSDSMLAHI
VALQFERVGQRLRERHGMDLEVEPAAAELVVARCVEVESGARMVDAILSQRVLPQIGRELLGASLQQRTW
RRVRVRAVDGEFACEYE
 
Nucleotide Sequence: 2574 bp     [Download]
>gi|33594723|ref|NC_002928.3|:764327-766900 Bordetella parapertussis 12822 chromosome, complete genome
ATGTCCGATATCGGCCGCGCCGAGCTGTTCGGCAAACTCGATTCCCTGTCCTATCGCGCCCTGGAGGACG
CCACCGCCCTGTGCAAGCTGCGCGGCAATCCCTACGTGGAGCTGGCGCACTGGGTGCACGCCATCGCGCA
CGCGCAGGACAGCGACCTGCACCATATCGCGCGCGCGTTCGAGCTGGATCTCGGCGCGCTGCAGCAAGAC
CTGGTGCGCGCGCTCGACCAATTGCCGCGCGGGGCGGGGGCGGTCTCGGACCTCTCCGAGCACGTGGACC
ACGTGGTGGAACGCGCCTGGGCGCTGGCGTCGCTGCGCTACGGCGCTGCGCGCATCCGCAGCGGGCACCT
GCTGCTGGCGCTGCTGCGCGACCCCAGCCTGCGCGGCGTGCTGGCCGGCATGTCGGGGCAGTTCGCCCGC
GTCGTGCCAGACCTGCTGCTGCAAGGCCTGCCCGAGATGACGCGCGGCTCGCCCGAGGCGCGCGCCGACG
CTGCCGTGGCCGATGCGCCGCCGGATGGCGGCGGCGCGGCCGGCGCGCTGGCGCGCTACGCGGTGGACCT
GACCGCCCAGGCGCGCGCCGGCCGGCTCGATCCGGTGACCGGGCGCGACGACGAAATCCGCCAGTTGATC
GACGTGCTGATGCGGCGGCGCCAGAACAATCCCCTGCTCACCGGCGAGGCCGGCGTGGGCAAGACCGCGG
TGGTCGAGGGCCTGGCCCTGCGGCTGGCGCGCGGCGATGTGCCGGCGCCGCTGCGCGAGGTGGCGCTGTA
CCTGCTGGATATCGGGCTGCTGCAGGCCGGCGCCGGCGTCAAGGGCGAGTTCGAGCAGCGCCTGCGCCAG
GTCATCGACGCGGTGCAGGGCAGCGAACGCCCCATCGTGCTGTTCATCGACGAAATCCATACCCTGGTGG
GGGCCGGCGGCGCGGCGGGGACGGGCGATGCCGCCAACCTGCTCAAGCCGGCGCTGGCGCGCGGACAGCT
GCGCACCATCGGCGCCACGACCTGGGCCGAATACAAGCAGTACATCGAGAAAGACCCGGCGCTGACGCGG
CGCTTCCAGGCCATCCAGGTGCACGAGCCCGACGAGGCCGGCGCGCGGCGCATGCTGCGCGGCCTGGCCG
GCGCCCTGCAGGCGCATCATGGCGTGCTGCTGCTGGACGAGGCCGTGGAGGCCGCCGTGCGGCTGTCGCA
TCGCTACATCCCGGCGCGCCAGTTGCCGGACAAGGCGGTCGCCCTGCTCGACACGGCCTGCGCGCGCGTG
GCGGTCAGCCAGCAGGCCACGCCGGCCGCGCTGGAAGACGCGCGCCGCCGCATCGACGCGCTGGATCTCG
AGCTGGAAATCGCCGCGCGCGAGGCGCGGCTGGACGCCGGCCCGGCCGAGCGCGTGGCGGGGCTGCGCGA
GCAGGGCCAGGCGGCGCGCTGGGAGCGCGAAGCGGCGCTGGCCGGCCAGGTGTTCGGCCTGCGCGAACAG
CTGGACGCGGCCGACGAGCAGTCCGCGCCGGCCTTGCGCGCCGCGCTGCGCGAGGCCGCCGACGCGCTGG
CGCGCAGCCAGGGCGAGGCGCCGCTGATCCACCCGGCGGTCGATGCCGCGGCCGTGGTGGCCGATTGGAC
CGGCATCCCCGTGGGCCGCATGGTGCGCGACGAAGCGCAGGCCGTGCTGGCGCTGGCCGACACCCTGGAG
CGCCGCGTCGTCGGCCAGCGCCATGCGCTGGAACTGATCGCGCGCCGCATCCAGACCGCGCGCGCCGGTC
TGACCGACCCGGGCAAGCCGGTCGGCGTGTTCCTGCTGTGCGGCCCGAGCGGCGTGGGCAAGACCGAGAC
CGCGCTGGCCCTGGCCGAGGCCCTGTATGGCGGCGAGCAGAATCTCATCACCATCAACATGAGCGAGTTC
CAGGAGTCGCACACGGTGTCGACCCTGAAGGGCGCGCCGCCGGGCTATGTGGGCTACGGCGAGGGCGGCG
TGCTGACCGAAGCGGTGCGGCGCCGCCCGCACAGCGTGGTGCTGCTCGACGAGGTCGAGAAAGCCCACGC
CGACGTGCACGAGATTTTCTTCCAGGTGTTCGACAAGGGGTGGATGGAAGACGGCGAAGGCCGTTACATC
GATTTCCGCAACACGGTCATCCTGTTGACCGCCAACGTGGGCGCGGACCTGATCGCCAGCCTGTGCGCCG
ACCCCGAGCTGGCGCCCGAGCCCGACGCGCTGGCGGCGGCCCTGCGCGCGCCGCTGCGCGACGTGTTTCC
CGCGGCCTTGCTGGGCCGCCTGGCGGCCGTGCCCTATCTGCCGCTGTCGGACAGCATGCTGGCGCATATC
GTGGCCTTGCAGTTCGAACGCGTCGGCCAGCGCCTGCGCGAGCGCCACGGCATGGATTTGGAAGTCGAGC
CGGCCGCCGCCGAGCTGGTGGTGGCGCGCTGCGTCGAGGTCGAATCCGGCGCGCGCATGGTCGACGCCAT
CCTGAGCCAGCGCGTCCTGCCGCAGATCGGCCGCGAATTGCTGGGCGCCTCCCTGCAGCAGCGCACCTGG
CGCCGCGTGCGGGTGCGGGCGGTCGACGGCGAGTTCGCCTGCGAGTACGAGTAG