SecReT6
Protein ID: 33595420
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0725
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]766999..767799 [-]
Producthypothetical protein
NoteFha
UniProt IDQ7W1G4
KEGG IDbpa:BPP0725
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0028, Aligned region: 27..94
Protein Sequence: 266 a.a.     [Download]
>gi|33595420|ref|NP_883063.1| unnamed protein product [Bordetella parapertussis 12822]
MMLTLIVRNPEPGASARRADFHAPGGTLGRDAENCLALPAAPGQLCRVQAALRADAQGWRLHNLSGMAAV
HINDAALAPGAVRAIQAGDTLRVGAHTLEVSGPDAPDARPAALPEAAADTPADAPRRGQAGAGAAEDIFS
GLFGPGTLPVGGTADAATHPFDLDSAQARNAADPLAHLPAGDAAVSRPAGDPLALFDAPHGGADVFADAT
PSALPAHDPLAPLRADPVRDTLLPRHAAGDGPAAHDHAPAGGTFLRPAAPRADQAD
 
Nucleotide Sequence: 801 bp     [Download]
>gi|33594723|ref|NC_002928.3|:c767799-766999 Bordetella parapertussis 12822 chromosome, complete genome
ATGATGCTGACGCTGATCGTACGCAACCCCGAGCCTGGCGCAAGCGCGCGCCGGGCGGATTTCCACGCGC
CCGGCGGCACGCTGGGCCGCGACGCCGAGAATTGCCTGGCCCTGCCGGCCGCGCCCGGCCAGCTATGCCG
CGTGCAGGCCGCGCTGCGCGCCGACGCGCAAGGCTGGCGCCTGCACAACCTGAGCGGCATGGCCGCGGTG
CACATCAACGACGCGGCGCTCGCGCCCGGCGCCGTGCGCGCCATCCAGGCGGGCGATACGCTGCGCGTGG
GCGCGCACACGCTGGAGGTGAGCGGGCCCGATGCGCCCGACGCACGGCCGGCAGCGCTGCCCGAGGCGGC
GGCGGACACGCCCGCCGATGCGCCCCGGCGCGGGCAAGCCGGCGCCGGGGCGGCCGAGGACATATTCAGC
GGCCTGTTCGGCCCCGGCACCCTGCCGGTGGGCGGCACCGCCGATGCCGCCACGCACCCCTTCGACCTGG
ATTCGGCGCAGGCGCGCAACGCCGCCGATCCGCTGGCGCATCTGCCGGCCGGCGACGCCGCGGTCAGCCG
CCCGGCGGGCGACCCGCTGGCGCTGTTCGACGCGCCGCATGGCGGCGCGGACGTGTTCGCCGACGCCACC
CCGTCGGCCCTGCCCGCGCACGATCCGCTGGCGCCGCTGCGCGCCGACCCGGTGCGCGACACGCTGCTGC
CGCGCCACGCGGCCGGCGACGGCCCGGCCGCGCACGACCATGCGCCGGCGGGAGGCACCTTCCTGCGCCC
GGCCGCGCCGCGCGCGGACCAGGCGGACTGA