SecReT6
Protein ID: 33595422
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0727
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]768487..769029 [+]
Productlipoprotein
NoteTssJ
UniProt IDQ7W1G2
KEGG IDbpa:BPP0727
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-39, Aligned region: 21..167
Protein Sequence: 180 a.a.     [Download]
>gi|33595422|ref|NP_883065.1| unnamed protein product [Bordetella parapertussis 12822]
MLVAVPTRRALRAAAWIAVAVLAAGCASTASRKAAPYAIELKADPRINPDASGRPSPIQVTLYELRSSAE
FEARDFFTLQGDAQAALGKSLIETDQVILQPGETRKLSYPGNTEARVVGIVAAYRDLERSPWRIVVPLPQ
AQNTNIYKFWQFSPNEETVRVAVGGQGVQIVDRERSWWPF
 
Nucleotide Sequence: 543 bp     [Download]
>gi|33594723|ref|NC_002928.3|:768487-769029 Bordetella parapertussis 12822 chromosome, complete genome
TTGCTTGTTGCTGTGCCCACGCGGCGCGCGTTGCGCGCGGCGGCCTGGATTGCCGTCGCGGTGCTGGCCG
CCGGGTGCGCGTCCACGGCCAGCCGCAAGGCGGCGCCTTACGCGATCGAGCTGAAGGCCGATCCGCGCAT
CAATCCCGATGCCTCGGGCCGGCCCTCGCCGATCCAGGTCACGCTGTACGAGCTGCGTTCGTCCGCCGAG
TTCGAGGCGCGCGATTTCTTCACCCTGCAAGGCGACGCGCAGGCCGCGCTGGGCAAGTCGCTCATCGAAA
CCGACCAGGTCATCCTGCAGCCCGGCGAAACCCGCAAGCTGTCGTATCCGGGCAATACCGAGGCGCGCGT
GGTCGGCATCGTGGCGGCCTATCGCGACCTCGAGCGCAGTCCCTGGCGCATCGTCGTGCCCCTGCCGCAG
GCCCAGAACACCAACATCTACAAGTTCTGGCAGTTCTCGCCCAACGAGGAGACCGTGCGCGTCGCGGTGG
GCGGACAGGGCGTGCAAATCGTCGACCGGGAGCGTTCCTGGTGGCCCTTCTGA