SecReT6
Protein ID: 33595423
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0728
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]769075..770409 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ7W1G1
KEGG IDbpa:BPP0728
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-156, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|33595423|ref|NP_883066.1| unnamed protein product [Bordetella parapertussis 12822]
MALDNKVVWSEGMFLRPQHFQQFERHIEAQLRVRAAVASGCGWGYTALEIDRDALALGKLALARAAGVLP
DGTPFEFERADEGPPALDIDPAMRDARVMLALPRRRAGACEVVYEDGADTLARYCVHEGEIEDSGSVGLE
PALVQLGRLRLRLVPETELGDEWVALGAARVLERRADHRVVLDEMYIPPWLAADANPALRGYAGELSGLL
QARGAALAQRLAQPGRGGVSEVADFLLLALVNRYAGALWHARQVPALHPERLFRDWLMLACDLATYTCAT
RLPEVLPDYRHDDLQASFGPLMAELRRSLSVVLEQHAVQIPLHDRGQGVRVAQIADAELLRSAGFVLAVH
ADMPAETVRTRFPAQVKIGPVERIRDLVHLQLPGVAVRALPVAPRQIPYSAGHVYFELDKNGEFWRQLER
TGALALHLAGEFPGLALEFWAVRD
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|33594723|ref|NC_002928.3|:769075-770409 Bordetella parapertussis 12822 chromosome, complete genome
ATGGCACTGGACAACAAGGTCGTCTGGTCGGAGGGCATGTTCCTGCGGCCGCAACATTTCCAGCAGTTCG
AACGGCATATCGAGGCGCAGTTGCGCGTGCGCGCCGCGGTGGCCTCGGGCTGCGGCTGGGGCTACACCGC
GCTGGAGATCGATCGCGACGCGCTGGCGCTGGGCAAGCTGGCGCTGGCGCGCGCCGCGGGCGTGCTGCCC
GACGGCACGCCGTTCGAGTTCGAGCGCGCCGACGAGGGGCCGCCGGCGCTGGACATCGACCCGGCCATGC
GCGATGCGCGCGTGATGCTGGCGCTGCCGCGCCGCCGCGCCGGCGCCTGCGAAGTGGTCTATGAAGACGG
CGCGGATACGCTGGCGCGCTATTGCGTGCATGAAGGCGAGATCGAGGACTCCGGCTCGGTGGGCCTGGAG
CCGGCGCTGGTGCAGCTGGGCCGTTTGCGCCTGCGGCTGGTTCCCGAAACCGAGCTGGGCGACGAATGGG
TGGCGCTGGGCGCCGCGCGGGTGCTGGAGCGCCGCGCCGACCACCGCGTGGTGCTCGACGAGATGTACAT
CCCGCCCTGGCTGGCCGCCGACGCCAATCCGGCGCTGCGCGGCTATGCCGGCGAGCTGTCCGGGCTGCTG
CAGGCGCGCGGAGCGGCGCTGGCGCAGCGGCTGGCGCAGCCGGGCCGCGGCGGCGTCTCCGAAGTGGCCG
ACTTCCTGCTGCTGGCGCTGGTAAACCGCTACGCCGGCGCGCTGTGGCACGCGCGCCAGGTGCCGGCCCT
GCATCCCGAACGGCTGTTTCGCGACTGGCTGATGCTGGCCTGCGACCTGGCCACCTATACCTGCGCCACG
CGCCTGCCCGAGGTGCTGCCCGATTACCGCCACGACGACCTGCAGGCCAGTTTCGGGCCGCTCATGGCCG
AGCTGCGCCGCTCGCTGTCGGTGGTGCTGGAGCAGCACGCCGTGCAGATCCCGCTGCATGACCGCGGCCA
GGGCGTGCGCGTGGCGCAGATCGCCGATGCCGAACTGCTGCGCAGCGCCGGCTTCGTGCTGGCCGTGCAC
GCCGACATGCCGGCCGAGACGGTGCGCACGCGCTTTCCGGCCCAGGTCAAGATCGGCCCGGTCGAGCGCA
TCCGCGACCTGGTGCACCTGCAATTGCCCGGCGTGGCGGTGCGCGCCCTGCCGGTGGCGCCGCGCCAGAT
TCCCTACAGCGCGGGCCACGTGTACTTCGAGCTGGACAAGAACGGCGAGTTCTGGCGGCAGCTGGAGCGC
ACCGGCGCGCTGGCCCTGCACCTGGCGGGCGAGTTTCCCGGCCTGGCGCTGGAGTTCTGGGCCGTGCGCG
ACTGA