SecReT6
Protein ID: 33595424
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0729
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]770430..771710 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ7W1G0
KEGG IDbpa:BPP0729
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.40E-75, Aligned region: 36..241
OmpA [PF00691], Evalue: 7.70E-14, Aligned region: 305..403
RskA [PF10099], Evalue: 0.003, Aligned region: 179..298
RskA [PF10099], Evalue: 0.003, Aligned region: 363..387
Protein Sequence: 426 a.a.     [Download]
>gi|33595424|ref|NP_883067.1| unnamed protein product [Bordetella parapertussis 12822]
MHAANPPFPDFGADAAADPGAASRLRPHEYVISGSNPLVAAANPLLDLIPQIRATTAHPAPAMLREYLVD
EVRQFELRAQQAGIPNETILGARYCLCTALDEAAALTPWGGGGVWSAHSLLVTFHNETWGGEKFFQLLAK
LSQNPGQHLDLLELLYYCLLLGFEGRYRVIDNGRTQLETLRQRLLRILRGARGEYPRALSPHWRDTPVQQ
ALRRLPVPLWAYGALAAALALALFWGLSWRLGERSDAVFAAVARLKPPTVQIAPAPRPAPAPRLAVFLQP
EVRDRLVTVRDEVDRSVVVLRGDGLFESGAVAVRDRYAPVLARVAEALGQTRGDIVVRGYTDNVPIRTAR
FPSNWHLSQARAEAVKAVIDARLGQAGRVRAEGRGEADPLAPNDTPAGRSVNRRVEITVMVPPAPHARTP
EEGATP
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|33594723|ref|NC_002928.3|:770430-771710 Bordetella parapertussis 12822 chromosome, complete genome
ATGCACGCCGCCAATCCTCCCTTTCCCGACTTCGGCGCCGACGCGGCGGCCGACCCCGGCGCGGCCAGCC
GGCTGCGCCCGCACGAGTACGTCATCAGCGGCTCCAACCCGCTGGTGGCGGCGGCCAATCCGCTGCTGGA
CCTGATCCCGCAGATCCGCGCCACCACGGCCCATCCCGCGCCGGCCATGCTGCGCGAGTACCTGGTCGAC
GAAGTGCGCCAGTTCGAGCTGCGCGCGCAACAGGCCGGCATTCCCAACGAAACCATCCTGGGCGCGCGCT
ACTGCCTGTGCACGGCGCTGGACGAGGCCGCCGCGCTCACGCCGTGGGGCGGGGGCGGCGTATGGTCGGC
GCACAGCCTGCTGGTGACGTTCCATAACGAAACCTGGGGCGGCGAGAAGTTCTTCCAGCTGCTGGCCAAG
CTGTCGCAGAACCCGGGCCAGCACCTGGATTTGCTGGAGCTGCTGTACTACTGCCTGCTGCTGGGCTTCG
AGGGCCGCTACCGCGTCATCGACAACGGCCGCACGCAGCTCGAGACCTTGCGCCAGCGCCTGCTGCGCAT
CCTGCGCGGCGCGCGCGGCGAGTATCCGCGCGCGCTCTCGCCGCATTGGCGCGACACGCCGGTGCAGCAG
GCGCTGCGCCGCCTGCCGGTGCCGCTGTGGGCCTACGGGGCGCTGGCGGCGGCGCTGGCGCTGGCGTTGT
TCTGGGGCCTGTCGTGGCGCCTGGGCGAACGCTCGGATGCCGTGTTCGCCGCGGTCGCGCGGCTCAAGCC
GCCCACGGTGCAGATCGCCCCGGCGCCGCGCCCGGCGCCCGCGCCCCGCCTGGCCGTGTTCCTGCAACCC
GAGGTGCGCGACCGCCTGGTGACGGTGCGCGACGAGGTCGATCGCAGCGTGGTGGTGCTGCGCGGCGACG
GGCTGTTCGAGTCGGGCGCGGTCGCGGTGCGCGACCGCTATGCGCCGGTGCTGGCGCGGGTGGCCGAGGC
GCTGGGCCAGACGCGCGGCGATATCGTGGTGCGCGGCTATACCGACAACGTTCCCATCCGCACGGCGCGC
TTTCCGTCCAACTGGCATCTGTCGCAGGCGCGCGCCGAGGCGGTCAAGGCGGTGATCGACGCGCGCCTGG
GCCAGGCCGGACGCGTGCGCGCAGAAGGGCGCGGCGAGGCCGATCCGCTGGCCCCCAATGACACCCCTGC
CGGACGCTCGGTCAACCGGCGGGTCGAAATTACCGTGATGGTGCCGCCGGCGCCGCATGCCCGCACGCCC
GAAGAAGGAGCCACGCCATGA