SecReT6
Protein ID: 33599782
SecReT6 ID9
T6SS typei3
Gene symbolvrgS
Locus tagBB0793
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]831107..833470 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ7WP92
KEGG IDbbr:BB0793
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-89, Aligned region: 31..335
Phage_GPD [PF05954], Evalue: 2.20E-89, Aligned region: 546..574
Phage_GPD [PF05954], Evalue: 2.20E-89, Aligned region: 649..661
Phage_base_V [PF04717], Evalue: 2.90E-25, Aligned region: 371..464
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 507..529
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 530..551
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 548..567
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 564..575
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 578..600
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 604..624
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 619..639
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 626..648
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 660..672
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 676..694
Protein Sequence: 787 a.a.     [Download]
>gi|33599782|ref|NP_887342.1| vrgS gene product [Bordetella bronchiseptica RB50]
METILAMAERIVRALTPLPPQALQFRSMHGHEGLSALYEFEVDLLAATHTLELKSLLGKPVSLEIETGGA
PRYLSGQATRCALVGREGDSARQYVYRVTMRPWLWYLTQTSDSKIFQQMSVVDVLRQVLADYPFPVEYRL
AGSYRRWEYCVQYQETDFAFVSRLMEHEGIYYWFRHESGRHTLVLTDDITQHDECPGAAQLPYYGPDRAT
VPQEQYVSQWQVAEEITPDGFATVDYDFKKPAASLDAQSSNPGAYEPGGLQVYEWLGGYTEPDQGERYSR
IRLEALQAHGESVTGACNVRAFAPGYLFTLRNHPRPAENRQYLIAQAHYRIQEGGYASGAEDAVFDIDFR
VLPATVPFRVARATPVPRTHGPQTATVVGQAGEEIWTDEYGRVKVHFHWDRYGKKNENSSCWVRVSSPWA
GGGFGGIQLPRVGDEVIVDFIGGYPDRPIVIGRVYNASNMPPWDLPGNATQSGFLSRSKNGDRGTANALM
FEDSAGAERIWLHAERDMDCEVEANESHTVDGNRTTLIGGNDTLTVRGTRTTTIDGLDTETFNAGATRTV
TGEVSETTTGNETRTFNGDVTETVNGVETRTVNGDWKETITGEMTETRTGDETRTVTGAVTETITGDVTQ
TITGAVTQTQTGAHDITITGDQTSSITGAVSHTVTGAYTQTVTDPVTVNANTSMTVVTPSWTVSSASQQA
FWTANTLRGTPARLTVVGAAADFWGVRQQVYGGINSQWSTVKIDLAAFKNGSNGFESGQAGAQIKAIGAQ
IKTGGAAVISRVINLFT
 
Nucleotide Sequence: 2364 bp     [Download]
>gi|33598993|ref|NC_002927.3|:831107-833470 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGGAGACGATCCTCGCAATGGCCGAACGCATCGTACGCGCCCTGACCCCGCTGCCCCCGCAAGCCCTGC
AGTTTCGCAGCATGCACGGCCACGAAGGCCTGTCGGCGCTGTACGAATTCGAGGTGGACCTGCTGGCGGC
CACCCATACGCTGGAACTGAAATCGCTGCTGGGCAAGCCGGTTTCGCTGGAAATCGAAACAGGCGGCGCG
CCGCGCTACCTGTCGGGCCAGGCGACCCGCTGCGCCCTGGTGGGGCGCGAAGGCGACAGCGCGCGCCAGT
ATGTGTACCGGGTGACCATGCGGCCCTGGCTGTGGTACCTGACGCAGACCTCGGACAGCAAGATCTTCCA
GCAGATGTCGGTGGTGGACGTGCTGCGCCAGGTGCTGGCCGACTACCCGTTTCCGGTCGAGTACCGGCTG
GCCGGCAGCTACCGCCGCTGGGAATACTGCGTGCAGTACCAGGAAACCGATTTCGCCTTCGTCAGCCGCC
TGATGGAGCACGAGGGCATCTACTACTGGTTCCGCCACGAGTCGGGCAGGCACACGCTGGTGCTGACCGA
CGACATCACCCAGCACGACGAGTGTCCGGGCGCGGCGCAGCTGCCGTATTACGGCCCGGATCGCGCCACG
GTGCCTCAGGAGCAATACGTATCGCAGTGGCAGGTGGCCGAGGAGATCACGCCCGATGGCTTCGCCACCG
TGGACTACGACTTCAAGAAGCCGGCCGCCAGCCTGGACGCGCAATCGAGCAACCCGGGCGCCTACGAGCC
GGGCGGGCTGCAGGTGTACGAGTGGCTGGGCGGCTATACCGAGCCGGACCAGGGCGAGCGCTATTCGCGC
ATCCGCCTGGAGGCCCTGCAGGCGCACGGCGAAAGCGTGACCGGCGCGTGCAACGTGCGCGCCTTCGCGC
CGGGTTACCTGTTCACGTTGCGCAACCATCCGCGCCCGGCCGAGAACCGCCAATACCTGATCGCGCAGGC
GCATTACCGCATCCAGGAAGGCGGCTACGCCAGCGGCGCCGAGGATGCCGTCTTCGATATCGACTTCCGC
GTCCTGCCGGCCACGGTGCCGTTTCGCGTGGCGCGCGCCACGCCGGTGCCGCGCACGCACGGGCCGCAGA
CCGCCACGGTGGTGGGCCAGGCCGGCGAAGAGATCTGGACCGACGAGTACGGCCGCGTCAAGGTGCACTT
CCACTGGGACCGCTACGGCAAGAAGAACGAGAACAGCTCGTGCTGGGTGCGCGTGTCCAGCCCCTGGGCC
GGCGGCGGCTTCGGCGGCATCCAGCTGCCGCGCGTGGGCGACGAAGTGATCGTGGACTTCATCGGCGGCT
ATCCCGACCGGCCCATTGTCATCGGCCGCGTCTACAACGCCAGCAACATGCCGCCCTGGGACCTGCCCGG
CAACGCCACGCAAAGCGGGTTTCTCAGCCGCTCCAAGAACGGCGACCGGGGCACCGCCAACGCGCTGATG
TTCGAGGACAGCGCGGGCGCCGAACGCATCTGGCTGCACGCCGAGCGCGACATGGACTGCGAGGTCGAGG
CCAACGAGTCGCACACGGTCGACGGCAACCGCACCACCCTGATCGGCGGCAACGATACGCTGACGGTGCG
GGGCACGCGCACCACCACCATTGACGGGCTGGACACCGAAACCTTCAACGCCGGCGCCACGCGCACCGTC
ACCGGCGAGGTGTCGGAGACCACCACCGGCAACGAGACGCGCACCTTCAACGGCGACGTGACCGAAACCG
TCAACGGCGTGGAGACGCGCACGGTCAACGGCGACTGGAAGGAAACCATCACCGGCGAGATGACCGAAAC
GCGCACGGGCGACGAAACCCGCACGGTGACCGGCGCCGTCACGGAGACCATTACCGGCGACGTGACGCAG
ACCATCACCGGCGCGGTCACGCAAACACAGACCGGCGCGCACGACATCACCATCACCGGCGACCAGACCT
CCAGCATCACCGGCGCGGTGTCGCACACGGTCACCGGCGCGTATACCCAGACGGTCACCGATCCGGTCAC
GGTCAACGCCAACACCAGCATGACCGTGGTCACGCCGTCGTGGACCGTCTCGTCGGCGTCGCAGCAGGCG
TTCTGGACCGCCAACACCTTGCGCGGCACGCCGGCGCGCCTGACGGTGGTCGGCGCCGCGGCCGACTTCT
GGGGCGTGCGCCAGCAGGTCTACGGCGGCATCAACTCGCAGTGGTCCACCGTGAAGATCGACCTGGCCGC
GTTCAAGAACGGCTCCAACGGCTTCGAGAGCGGTCAGGCCGGCGCGCAGATCAAGGCCATCGGCGCGCAG
ATCAAGACCGGCGGGGCGGCGGTGATCTCGCGCGTCATCAATCTCTTCACCTAG