SecReT6
Protein ID: 33599788
SecReT6 ID9
T6SS typei3
Gene symbol-
Locus tagBB0799
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]839515..840564 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ7WP86
KEGG IDbbr:BB0799
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-23, Aligned region: 59..118
ImpA-rel_N [PF06812], Evalue: 1.20E-23, Aligned region: 228..244
Protein Sequence: 349 a.a.     [Download]
>gi|33599788|ref|NP_887348.1| unnamed protein product [Bordetella bronchiseptica RB50]
MPRMTTNMEFADLLKTLTPSLPCGEDLEYDADFLQLQQAAVGRSEQQFGATIIPAQAPDWRAVERLALGL
LERTRDLRIIAYLTRAWTEMRGLPGYAEGVTLAAGTLEQYWDAVHPMLASGGEEDPMPRVNALASLGDPQ
GCVRGMRSACLLDDVHGRLSLRDAEALLDGGRSEADYPGGRTRLIENLRQARLRRDDAALAVGAAAGALR
RIQQQATQRLGSAWCPDYAQALRALDALLRTWSDLDETAAAPAAAMPAEAHHAAPAPEPQPAPASWHDAR
IATREDAMAMLAKVSAYFETHEPSHPAPYLIRRVQQLIPLDFHDILRNLAPQGLAQFEAWTAREAASQS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|33598993|ref|NC_002927.3|:839515-840564 Bordetella bronchiseptica RB50 chromosome, complete genome
TTGCCGCGCATGACGACGAACATGGAATTTGCCGACCTGTTGAAGACGCTGACGCCCAGCCTGCCCTGCG
GGGAGGACCTGGAGTACGACGCTGATTTCCTGCAGTTGCAGCAGGCCGCCGTGGGCCGCAGCGAGCAGCA
GTTCGGCGCCACCATCATCCCCGCGCAGGCGCCCGACTGGCGCGCGGTGGAGCGGCTGGCGCTGGGGCTG
CTGGAGCGCACGCGCGACCTGCGCATCATCGCCTACCTGACGCGCGCCTGGACCGAGATGCGCGGCCTGC
CCGGCTATGCCGAGGGCGTGACGCTGGCCGCCGGCACGCTGGAGCAATACTGGGACGCGGTGCATCCGAT
GCTGGCCAGCGGCGGCGAGGAAGACCCGATGCCGCGCGTCAATGCGCTGGCCTCGCTGGGCGACCCGCAG
GGCTGCGTGCGCGGCATGCGCTCGGCCTGCCTGCTCGACGATGTGCATGGCCGCCTGTCGCTGCGCGATG
CCGAGGCCCTGCTCGACGGCGGCAGGAGCGAGGCCGACTATCCGGGCGGGCGCACGCGCCTGATCGAGAA
CCTGCGCCAGGCGCGCCTGCGGCGCGACGACGCGGCGCTGGCCGTGGGCGCGGCCGCCGGCGCGCTGCGC
CGCATCCAGCAGCAGGCCACCCAGCGCCTGGGCTCGGCCTGGTGTCCGGACTATGCGCAGGCGCTGCGCG
CGCTGGATGCCTTGCTGCGCACCTGGAGCGACCTGGACGAAACCGCGGCGGCGCCCGCCGCGGCCATGCC
GGCCGAAGCGCATCACGCGGCCCCGGCGCCTGAACCCCAACCCGCGCCCGCCAGCTGGCACGACGCGCGC
ATCGCCACGCGCGAAGACGCGATGGCCATGCTGGCCAAGGTCAGCGCCTACTTCGAAACCCATGAGCCCA
GCCATCCGGCGCCCTATCTGATCCGCCGGGTGCAGCAGCTCATTCCCCTGGATTTCCACGACATCCTGCG
CAACCTGGCCCCGCAGGGCCTGGCGCAGTTCGAGGCGTGGACCGCGCGCGAGGCCGCCAGCCAGTCCTAG