SecReT6
Protein ID: 33599789
SecReT6 ID9
T6SS typei3
Gene symbol-
Locus tagBB0800
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]840607..841170 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ7WP85
KEGG IDbbr:BB0800
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.80E-57, Aligned region: 13..165
Protein Sequence: 187 a.a.     [Download]
>gi|33599789|ref|NP_887349.1| unnamed protein product [Bordetella bronchiseptica RB50]
MATTLKGSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKSNTPQPEVGERKFLDVDID
NFDERMKSVAPRAAFQVANTLTGAGHLNVDITFESIDDFSPATVARKVGALNEMLEARTQLANLLTYMDG
KTGAEELIGQVLQNPALLGALAAAPKPADAGPADADAESAQPGPQAR
 
Nucleotide Sequence: 564 bp     [Download]
>gi|33598993|ref|NC_002927.3|:840607-841170 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGGCAACCACGCTCAAAGGCAGCGGCCAGAAATTCATCGCCAGGAATCGCGCGCCGCGCGTGCAGATCG
AGTACGACGTGGAGATCTACGGCGCCGAGCGCAAGATCCAGCTGCCCTTCGTCATGGGCGTGCTGGCCGA
CCTGGCCGGCAAGTCGAACACGCCGCAGCCCGAAGTGGGCGAGCGCAAGTTCCTCGACGTAGATATCGAC
AATTTCGACGAGCGCATGAAGTCGGTCGCCCCGCGGGCCGCGTTCCAGGTGGCCAATACGCTGACCGGCG
CCGGCCATCTGAACGTGGACATCACCTTCGAGAGCATCGACGATTTTTCCCCGGCCACCGTGGCGCGCAA
GGTGGGCGCGCTCAACGAGATGCTGGAGGCCCGCACGCAGCTGGCCAACCTGCTGACCTACATGGACGGC
AAGACCGGCGCCGAGGAGCTGATCGGCCAGGTGCTGCAGAACCCGGCCCTGCTGGGCGCGCTGGCGGCCG
CGCCCAAGCCCGCCGACGCCGGGCCGGCCGATGCCGACGCCGAGAGCGCGCAGCCCGGCCCGCAAGCCCG
ATAA