SecReT6
Protein ID: 33599791
SecReT6 ID9
T6SS typei3
Gene symbol-
Locus tagBB0802
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]842770..843237 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ7WP83
KEGG IDbbr:BB0802
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-36, Aligned region: 1..129
Protein Sequence: 155 a.a.     [Download]
>gi|33599791|ref|NP_887351.1| unnamed protein product [Bordetella bronchiseptica RB50]
MKIEGANGESKDANHKDWTDIVSFSWGATQPASLATGGGQGAGKASFNDLHVVARIDKAAPAVMKHCASG
KHLGKIELSVCKAGGAQVEYSKVTLEDVLVTSVQIAADNGSEAVLVNYAFQAAKVRQQYWEQTESGGKGA
ESLVAWDIKQNKEIG
 
Nucleotide Sequence: 468 bp     [Download]
>gi|33598993|ref|NC_002927.3|:842770-843237 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGAAGATCGAAGGCGCCAATGGCGAATCCAAGGACGCCAACCACAAGGACTGGACCGATATCGTGTCCT
TTTCGTGGGGCGCCACCCAGCCGGCCAGCCTGGCGACCGGCGGCGGCCAGGGCGCGGGCAAGGCCAGCTT
CAACGATCTGCACGTGGTGGCCCGCATCGACAAGGCGGCGCCGGCGGTCATGAAGCACTGCGCCAGCGGC
AAGCACCTGGGCAAGATCGAACTGTCGGTGTGCAAGGCGGGCGGCGCGCAGGTCGAGTACAGCAAGGTCA
CGCTGGAAGACGTGCTGGTCACCTCGGTGCAGATCGCCGCGGACAACGGTTCGGAGGCGGTGCTGGTCAA
CTATGCCTTCCAGGCCGCCAAGGTGCGCCAGCAGTACTGGGAGCAGACCGAGTCGGGCGGCAAGGGCGCC
GAGAGCCTGGTCGCGTGGGACATCAAGCAGAACAAGGAAATCGGCTGA