SecReT6
Protein ID: 33599792
SecReT6 ID9
T6SS typei3
Gene symbol-
Locus tagBB0803
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]843287..844096 [+]
Producthypothetical protein
NoteTagJ
UniProt IDQ7WP82
KEGG IDbbr:BB0803
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 5.70E-44, Aligned region: 147..265
Protein Sequence: 269 a.a.     [Download]
>gi|33599792|ref|NP_887352.1| unnamed protein product [Bordetella bronchiseptica RB50]
MQTSVLAMPPRDGGLAGQAAAVQARIRRAPADADLRAQLFQLAAVQGDWRRAAEQLQLCARLNPLAQPMA
NLYLAAIHGELRREAVLAGQAEPGFLAERPCWCEPLLQALRAQASDPERAAMLRAQAFDAAQASAGTLED
AAAGQAGYAWICDGDSRLGPVCELILDGSYAWLPFAQVAAVHLPAPQGLCDLVWARAEIALADGAVVRGL
VPARYPPSAGQDDGLRLGRATCWRPLGQDGYAGEGQKMWLTDAGEFALLDVRALRQQAP
 
Nucleotide Sequence: 810 bp     [Download]
>gi|33598993|ref|NC_002927.3|:843287-844096 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGCAGACATCCGTGCTTGCGATGCCCCCGCGCGACGGCGGCCTGGCCGGTCAGGCCGCGGCCGTGCAGG
CGCGCATCCGGCGCGCGCCGGCCGACGCCGATTTGCGCGCGCAACTTTTCCAGCTGGCTGCCGTGCAGGG
CGACTGGCGCCGCGCCGCCGAGCAATTGCAACTGTGCGCCCGGCTGAACCCGCTGGCCCAGCCGATGGCC
AATCTCTACCTGGCGGCCATCCATGGCGAGCTGCGGCGCGAAGCCGTGCTGGCGGGCCAGGCCGAACCCG
GCTTCCTGGCCGAGCGGCCCTGCTGGTGCGAGCCGTTGCTGCAGGCGCTGCGCGCCCAGGCGAGCGACCC
CGAGCGGGCCGCCATGCTGCGCGCCCAGGCGTTCGATGCGGCGCAGGCCAGCGCCGGCACGCTGGAGGAC
GCGGCCGCCGGCCAGGCCGGCTATGCCTGGATCTGCGACGGCGACAGCCGCCTGGGGCCGGTCTGCGAAC
TGATTCTCGACGGCAGCTATGCGTGGCTGCCGTTCGCGCAGGTGGCCGCCGTGCATCTGCCGGCCCCGCA
AGGGCTGTGCGATCTCGTCTGGGCGCGCGCCGAAATCGCCCTGGCCGACGGCGCGGTCGTGCGCGGCCTG
GTTCCGGCGCGCTACCCGCCGTCGGCCGGGCAGGATGACGGCCTGAGGCTGGGCCGGGCCACGTGCTGGC
GGCCGCTGGGCCAGGACGGTTACGCCGGCGAGGGCCAGAAGATGTGGCTGACCGACGCGGGCGAGTTCGC
GCTGCTGGACGTGCGCGCCCTGCGCCAGCAGGCGCCATGA