SecReT6
Protein ID: 33599794
SecReT6 ID9
T6SS typei3
Gene symbol-
Locus tagBB0805
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]844611..846524 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ7WP80
KEGG IDbbr:BB0805
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-212, Aligned region: 5..636
Protein Sequence: 637 a.a.     [Download]
>gi|33599794|ref|NP_887354.1| unnamed protein product [Bordetella bronchiseptica RB50]
MDARLLDYYNRELVYMRELGAEFARQHPKVAGRLGMHGTEVADPYVERLLEGFSFLAARIHLKMDAEFPR
FTQRLLEVVHPHYLAPTPAMAVAQFSPSMNEGTLAGGFTLPRGTVLRGGLARGEQTPCEFMTGHALRLWP
LRVTAAELTGAPTDLPLARLGLGGREAGVASALRLRLEVCGGVSLEELDLDQLVFYLNGPDAPMQRLLEL
IMCHTVAVLGHDSERPVSWINRLPADAVRHEGFADDQALLPTDTRVFQGYRLLQEYFAFARRYLFFSLNG
LKQGLCTRRAAPAAAAGPAGTRRFDLTLLLSAAAPELEGAISAGNLALHCAPIVNLFPRRADRVAVTPRH
HEYHVVVDRTRPLDFEVYSLTRVLGHMSAQRPEQEFRPFYGSFGADADDYGAYYSLRREPRLASDSARRH
GTRTSYTGSEVYLSLVDRHEAPFADTLRHLGIDALCTNRDLALLLPLGGASDFSLRVSAPVGAIKVLHGP
SRPAAAMADHGTAWQLISHLGLHYHSLTDLDETRGAQTLRELLNLYGNLADPVARKHISGVRHVRVEPMH
HRLPVPGPIVYGRGVRIDLQVDETAFSGISPYLFGAVLEQFFARHVSINMMSALTLSTPQRGAVASWRPR
MGRRPAV
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|33598993|ref|NC_002927.3|:844611-846524 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGGACGCGCGCCTGCTCGACTACTACAACCGCGAGCTGGTCTATATGCGCGAGCTGGGCGCCGAGTTCG
CGCGCCAGCATCCCAAGGTGGCGGGGCGGCTGGGCATGCACGGCACCGAGGTGGCCGACCCGTACGTCGA
GCGCCTGCTCGAAGGCTTCAGCTTCCTGGCCGCGCGCATCCACCTGAAGATGGACGCCGAGTTTCCGCGC
TTCACGCAGCGGCTGCTGGAGGTGGTGCATCCGCACTATCTCGCGCCCACCCCGGCGATGGCGGTGGCGC
AGTTCTCGCCCAGCATGAACGAAGGCACGCTGGCCGGCGGCTTTACCCTGCCGCGCGGCACCGTGCTGCG
CGGCGGCCTGGCGCGTGGCGAACAGACGCCGTGCGAGTTCATGACCGGCCACGCGCTGCGGCTGTGGCCG
CTGCGCGTGACGGCGGCCGAACTCACCGGCGCGCCCACCGACCTGCCGCTGGCCCGCCTGGGCCTGGGCG
GACGCGAGGCCGGCGTGGCCAGCGCGCTGCGCCTGCGGCTGGAAGTCTGCGGCGGCGTCAGCCTGGAAGA
GCTGGACCTGGATCAACTGGTGTTCTACCTCAACGGGCCGGACGCGCCCATGCAGCGCCTGCTGGAGCTG
ATCATGTGCCACACGGTCGCCGTGCTGGGCCACGACAGCGAGCGGCCCGTCTCGTGGATCAACCGGCTGC
CGGCCGACGCGGTGCGCCACGAGGGGTTCGCCGACGACCAGGCGCTGCTGCCCACCGACACGCGGGTCTT
CCAGGGCTATCGGCTGCTGCAGGAGTACTTCGCGTTCGCGCGCCGCTATCTGTTCTTCAGCCTGAACGGC
CTGAAGCAGGGCCTGTGCACGCGGCGCGCGGCGCCGGCCGCGGCGGCTGGCCCGGCCGGCACCCGGCGTT
TCGACCTGACGCTGCTGCTGTCGGCCGCAGCGCCCGAGCTCGAAGGCGCGATCTCGGCCGGGAACCTGGC
GCTGCACTGCGCGCCCATCGTCAACCTGTTTCCGCGCCGCGCCGACCGCGTGGCGGTCACGCCGCGCCAC
CACGAGTACCACGTGGTGGTCGACCGCACCCGGCCGCTGGACTTCGAGGTCTACAGCCTGACGCGGGTGC
TCGGCCATATGTCGGCGCAGCGCCCCGAACAGGAGTTCCGTCCGTTCTACGGCTCGTTCGGCGCGGACGC
CGACGATTACGGCGCCTATTACTCGTTGCGGCGCGAGCCGCGGCTGGCCTCGGACAGCGCGCGCCGCCAT
GGCACGCGCACCAGCTATACCGGCAGCGAAGTCTATCTGTCGCTGGTCGATCGGCACGAGGCGCCGTTTG
CCGATACGCTGCGCCATCTCGGCATCGACGCGCTGTGCACCAACCGCGACCTGGCGCTGCTGCTGCCGCT
GGGCGGCGCCAGCGATTTCAGCCTGCGCGTGTCCGCCCCGGTGGGCGCGATCAAGGTGCTGCATGGGCCG
TCGCGGCCGGCCGCGGCCATGGCCGACCACGGCACGGCATGGCAATTGATCAGCCACCTGGGGCTGCACT
ACCACAGCCTGACCGACCTGGACGAGACGCGCGGCGCGCAGACGCTGCGCGAGCTGCTCAACCTGTACGG
CAACCTGGCCGATCCGGTGGCGCGCAAGCATATCTCGGGCGTGCGCCACGTGCGGGTCGAACCCATGCAC
CACCGCCTGCCCGTGCCCGGCCCCATCGTCTACGGCCGCGGCGTGCGCATCGACCTGCAGGTCGACGAGA
CCGCCTTCTCGGGCATCAGCCCCTACCTGTTCGGCGCGGTGCTGGAGCAGTTCTTCGCGCGCCACGTCTC
CATCAACATGATGTCGGCGCTCACCCTGTCCACGCCGCAGCGCGGCGCCGTGGCGAGCTGGCGGCCCCGC
ATGGGCCGCCGTCCCGCGGTCTAG