SecReT6
Protein ID: 33599796
SecReT6 ID9
T6SS typei3
Gene symbol-
Locus tagBB0807
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]847215..848309 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ7WP78
KEGG IDbbr:BB0807
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-111, Aligned region: 28..328
Protein Sequence: 364 a.a.     [Download]
>gi|33599796|ref|NP_887356.1| unnamed protein product [Bordetella bronchiseptica RB50]
MSMDAAARTDRHAALAVLPPAFWQALAAAPHGHDLFHVLRWIDARAGARAPLGRGASPRHEPVRMRQEPS
LAFAPATLAAARAPGEGAAPELSIYSFGLFGPNGPLPLHLTEHARERRQHHGDHSLAAFADLFHHRLILL
FYRAWADAQSTASLDRGQERFSGYVASLLHLGAPSLRRRDSVMDHAKYHMAGHLLRQTRNPEGLCQVLRA
FFGLPVGVDEFVAQWIRLEAGQRLRLGAGGGLGGGAPLGVAVRDAQHKFRIRLGPLDWQDYLAFLPGSAR
ARQLLHWVRLYVGVEFAWEVRPVLRRDAVRGVRLGAAAPLGLASWLGRRPPRLGDAAELLLDYEGRERQA
ARRAQAFHEKEQAA
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|33598993|ref|NC_002927.3|:847215-848309 Bordetella bronchiseptica RB50 chromosome, complete genome
TTGAGCATGGACGCAGCGGCCAGGACGGATCGACACGCGGCGCTGGCGGTGCTGCCGCCTGCCTTCTGGC
AGGCCCTGGCGGCGGCGCCGCACGGGCACGACCTGTTTCACGTGCTGCGCTGGATCGACGCGCGCGCCGG
CGCGCGCGCGCCGCTGGGCCGCGGCGCCTCGCCGCGCCACGAACCGGTGCGCATGCGGCAGGAGCCTTCG
CTGGCTTTCGCGCCGGCCACCCTGGCCGCGGCGCGCGCGCCGGGCGAGGGCGCCGCGCCCGAGCTGTCCA
TCTACAGCTTCGGCCTGTTCGGTCCCAATGGGCCGCTGCCGCTGCACCTGACCGAGCACGCCCGCGAACG
CCGCCAGCATCACGGCGACCACTCCCTGGCCGCGTTCGCCGACCTGTTCCACCATCGCCTGATCCTGCTG
TTCTACCGCGCCTGGGCCGATGCGCAGTCCACCGCCAGCCTGGACCGCGGCCAGGAGCGCTTCAGCGGCT
ACGTGGCCAGCCTGCTGCACCTGGGCGCGCCGTCGCTGCGCCGGCGCGACAGCGTGATGGACCATGCCAA
GTACCACATGGCCGGCCATCTGCTGCGCCAGACCCGCAACCCGGAAGGCCTGTGCCAGGTGCTGCGCGCC
TTCTTCGGCCTGCCCGTGGGGGTAGACGAGTTCGTGGCGCAGTGGATAAGGTTGGAGGCCGGCCAGCGGC
TGCGGCTGGGGGCGGGCGGCGGGCTGGGCGGCGGCGCGCCCCTGGGCGTGGCCGTGCGCGACGCCCAGCA
CAAGTTCAGGATCCGCCTCGGGCCGCTGGACTGGCAGGACTACCTGGCGTTCCTGCCCGGTTCGGCCCGC
GCGCGCCAGCTGCTGCATTGGGTGCGCCTGTATGTGGGCGTGGAGTTCGCCTGGGAGGTGCGGCCGGTGC
TGCGCCGCGACGCGGTGCGCGGCGTGCGCCTGGGCGCGGCGGCGCCGCTGGGGCTGGCGTCCTGGCTGGG
CCGGCGGCCGCCGCGCCTGGGCGACGCCGCCGAGCTGTTGCTGGACTACGAGGGGCGCGAGCGCCAGGCG
GCGCGGCGCGCGCAAGCGTTTCATGAAAAGGAGCAAGCGGCATGA