SecReT6
Protein ID: 33599800
SecReT6 ID9
T6SS typei3
Gene symbol-
Locus tagBB0811
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]851938..852738 [-]
Producthypothetical protein
NoteFha
UniProt IDQ7WP74
KEGG IDbbr:BB0811
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0028, Aligned region: 27..94
Protein Sequence: 266 a.a.     [Download]
>gi|33599800|ref|NP_887360.1| unnamed protein product [Bordetella bronchiseptica RB50]
MMLTLIVRNPEPGASARRADFHAPGGTLGRDAENCLALPAAPGQLCRVQAALRADAQGWRLHNLSGMAAV
HINDAALAPGAVRAIQAGDTLRVGAHTLEVSGPDAPDARPAALPEAAADTPADAPRRGQAGAGAAEDIFS
GLFGPGTLPVGGIADAATHPFDLDSAQARNAADPLAHLPAGDAAVSRPAGDPLALFDAPHGGADVFADAT
PSALPAHDPLAPLRADPVRDTLLPRHAAGDGPAAHDHAPAGGTFLRPAAPRADQAD
 
Nucleotide Sequence: 801 bp     [Download]
>gi|33598993|ref|NC_002927.3|:c852738-851938 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGATGCTGACGCTGATCGTACGCAACCCCGAGCCTGGCGCAAGCGCGCGCCGGGCGGATTTCCACGCGC
CCGGCGGCACGCTGGGCCGCGACGCCGAGAATTGCCTGGCCCTGCCGGCCGCGCCCGGCCAGCTATGCCG
CGTGCAGGCCGCGCTGCGCGCCGACGCGCAAGGCTGGCGCCTGCACAACCTGAGCGGCATGGCCGCGGTG
CACATCAACGACGCGGCGCTCGCGCCCGGCGCCGTGCGCGCCATCCAGGCGGGCGATACGCTGCGCGTGG
GCGCGCACACGCTGGAGGTGAGCGGGCCCGATGCGCCCGACGCACGGCCGGCAGCGCTGCCCGAGGCGGC
GGCGGACACGCCCGCCGATGCGCCCCGGCGCGGGCAAGCCGGCGCCGGGGCGGCCGAGGACATATTCAGC
GGCCTGTTCGGCCCCGGCACCCTGCCGGTGGGCGGCATCGCCGATGCCGCCACGCACCCCTTCGACCTGG
ATTCGGCGCAGGCGCGCAACGCCGCCGATCCGCTGGCGCATCTGCCGGCCGGCGACGCCGCGGTCAGCCG
CCCGGCGGGCGACCCGCTGGCGCTGTTCGACGCGCCGCATGGCGGCGCGGACGTGTTCGCCGACGCCACC
CCGTCGGCCCTGCCCGCGCACGATCCGCTGGCGCCGCTGCGCGCCGACCCGGTGCGCGACACGCTGCTGC
CGCGCCACGCGGCCGGCGACGGCCCGGCCGCGCACGACCATGCGCCGGCGGGAGGCACCTTCCTGCGCCC
GGCCGCGCCGCGCGCGGACCAGGCGGACTGA