SecReT6
Protein ID: 33599802
SecReT6 ID9
T6SS typei3
Gene symbol-
Locus tagBB0813
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]853426..853968 [+]
Productlipoprotein
NoteTssJ
UniProt IDQ7WP72
KEGG IDbbr:BB0813
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.00E-39, Aligned region: 21..167
Protein Sequence: 180 a.a.     [Download]
>gi|33599802|ref|NP_887362.1| unnamed protein product [Bordetella bronchiseptica RB50]
MLVAVPTRRALRAAAWIAVAVLAAGCASTASRKAAPYAIELKADPRVNPDASGRPSPIQVTLYELRSSAE
FEARDFFTLEGDAQAALGKSLIETDQVILQPGETRKLSYPGNTEARVVGIVAAYRDLERSPWRIVVPLPQ
AQNTNIYKFWQFSPNEETVRVAVGGQGVQIVDRERSWWPF
 
Nucleotide Sequence: 543 bp     [Download]
>gi|33598993|ref|NC_002927.3|:853426-853968 Bordetella bronchiseptica RB50 chromosome, complete genome
TTGCTTGTTGCTGTGCCCACGCGGCGCGCGTTGCGCGCGGCGGCCTGGATTGCCGTCGCGGTGCTGGCCG
CCGGGTGCGCGTCCACGGCCAGCCGCAAGGCGGCGCCTTACGCGATCGAGCTGAAGGCCGATCCGCGCGT
CAATCCCGATGCCTCGGGCCGGCCCTCGCCGATCCAGGTCACGCTGTACGAGCTGCGTTCGTCCGCCGAG
TTCGAGGCGCGCGATTTCTTCACCCTGGAAGGCGACGCGCAGGCCGCGCTGGGCAAGTCGCTCATCGAAA
CCGATCAGGTCATCCTGCAGCCCGGCGAAACCCGCAAGCTGTCGTATCCGGGCAATACCGAGGCGCGCGT
GGTCGGCATCGTGGCGGCCTATCGCGACCTCGAGCGCAGTCCCTGGCGCATCGTCGTGCCCCTGCCGCAG
GCCCAGAACACCAACATCTACAAGTTCTGGCAGTTCTCGCCCAACGAGGAGACCGTGCGCGTCGCGGTGG
GCGGACAGGGCGTGCAAATCGTCGACCGGGAGCGTTCCTGGTGGCCCTTCTGA