SecReT6
Protein ID: 33599803
SecReT6 ID9
T6SS typei3
Gene symbol-
Locus tagBB0814
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]854014..855348 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ7WP71
KEGG IDbbr:BB0814
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.40E-157, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|33599803|ref|NP_887363.1| unnamed protein product [Bordetella bronchiseptica RB50]
MALDNKVVWSEGMFLRPQHFQQFERHIEAQLRVRAAAASGCGWGYTALEIDRDALALGKLALARAAGVLP
DGTPFEFERADEGPPALDIDPAMRDARVMLALPRRRAGACEVVYEDGADTLARYCVHEGEIEDSGSVGLE
PALVQLGRLRLRLVPETELGDEWVALGAARVLERRADHRVVLDEMYIPPWLAADANPALRGYAGELSGLL
QARAAALAQRLAQPGRGGVSEVADFLLLALVNRYAGALWHARQVPALHPERLFRDWLMLACDLATYTCAT
RLPEVLPDYRHDDLQASFGPLMAELRRSLSVVLEQHAVQIPLHDRGQGVRVAQIADAELLRSAGFVLAVH
ADMPAETVRTRFPAQVKIGPVERIRDLVHLQLPGVAVRALPVAPRQIPYSAGHVYFELDKNGEFWRQLER
TGALALHLAGEFPGLALEFWAVRD
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|33598993|ref|NC_002927.3|:854014-855348 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGGCACTGGACAACAAGGTCGTCTGGTCGGAGGGCATGTTCCTGCGGCCGCAACATTTCCAGCAGTTCG
AACGGCATATCGAGGCGCAGTTGCGCGTGCGCGCCGCGGCGGCCTCGGGCTGCGGCTGGGGCTACACCGC
GCTGGAGATCGATCGCGACGCGCTGGCGCTGGGCAAGCTGGCGCTGGCGCGCGCCGCGGGCGTGCTGCCC
GACGGCACGCCGTTCGAGTTCGAGCGCGCCGACGAGGGGCCGCCGGCGCTGGACATCGACCCGGCCATGC
GCGATGCGCGCGTGATGCTGGCGCTGCCGCGCCGCCGCGCCGGCGCCTGCGAAGTGGTCTACGAAGACGG
CGCGGATACGCTGGCGCGCTATTGCGTGCATGAAGGCGAGATCGAGGACTCCGGCTCGGTGGGCCTGGAG
CCGGCGCTGGTGCAGCTGGGCCGTTTGCGCCTGCGGCTGGTTCCCGAAACCGAGCTGGGCGACGAATGGG
TGGCGCTGGGCGCCGCGCGGGTGCTGGAGCGCCGCGCCGACCACCGCGTGGTGCTCGACGAGATGTACAT
CCCGCCCTGGCTGGCCGCCGACGCCAATCCGGCGCTGCGCGGCTATGCCGGCGAGCTGTCCGGGCTGCTG
CAGGCGCGCGCAGCGGCGCTGGCGCAGCGGCTGGCGCAGCCGGGCCGCGGCGGCGTCTCCGAAGTGGCCG
ACTTCCTGCTGCTGGCGCTGGTAAACCGCTACGCCGGCGCGCTGTGGCACGCGCGCCAGGTGCCGGCCCT
GCATCCCGAACGGCTGTTTCGCGACTGGCTGATGCTGGCCTGCGACCTGGCCACCTATACCTGCGCCACG
CGCCTGCCCGAGGTGCTGCCCGATTACCGCCACGACGACCTGCAGGCCAGTTTCGGGCCGCTCATGGCCG
AGCTGCGCCGCTCGCTGTCGGTGGTGCTGGAGCAGCACGCCGTGCAGATCCCGCTGCATGACCGCGGCCA
GGGCGTGCGCGTGGCGCAGATCGCCGATGCCGAACTGCTGCGCAGCGCCGGCTTCGTGCTGGCCGTGCAC
GCCGACATGCCGGCCGAGACGGTGCGCACGCGCTTTCCGGCCCAGGTCAAGATCGGCCCGGTCGAGCGCA
TCCGCGACCTGGTGCACCTGCAATTGCCCGGCGTGGCGGTGCGCGCCCTGCCGGTGGCGCCGCGCCAGAT
TCCCTACAGCGCGGGCCACGTGTACTTCGAGCTGGACAAGAACGGCGAGTTCTGGCGGCAGCTGGAGCGC
ACCGGCGCGCTGGCCCTGCACCTGGCGGGCGAGTTTCCCGGCCTGGCGCTGGAGTTCTGGGCCGTGCGCG
ACTGA