SecReT6
Protein ID: 33599804
SecReT6 ID9
T6SS typei3
Gene symbol-
Locus tagBB0815
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]855369..856649 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ7WP70
KEGG IDbbr:BB0815
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.40E-75, Aligned region: 36..241
OmpA [PF00691], Evalue: 7.70E-14, Aligned region: 305..403
RskA [PF10099], Evalue: 0.003, Aligned region: 179..298
RskA [PF10099], Evalue: 0.003, Aligned region: 363..387
Protein Sequence: 426 a.a.     [Download]
>gi|33599804|ref|NP_887364.1| unnamed protein product [Bordetella bronchiseptica RB50]
MHAANPPFPDFGADAAADPGAASRLRPHEYVISGSNPLVAAANPLLDLIPQIRATTAHPAPAMLREYLVD
EVRQFELRAQQAGIPNETILGARYCLCTALDEAAALTPWGGGGVWSAHSLLVTFHNETWGGEKFFQLLAK
LSQNPGQHLDLLELLYYCLLLGFEGRYRVIDNGRTQLETLRQRLLRILRGARGEYPRALSPHWRDTPVQQ
ALRRLPVPLWAYGALAAALALALFWGLSWRLGERSDAVFAAVARLKPPTVQIAPAPRPAPAPRLAVFLQP
EVRDRLVTVRDEVDRSVVVLRGDGLFESGAVAVRDRYAPVLARVAEALGQTRGDIVVRGYTDNVPIRTAR
FPSNWHLSQARAEAVKAVIDARLGQAGRVRAEGRGEADPLAPNDTPAGRSVNRRVEITVMVPPAPHARTP
EEGATP
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|33598993|ref|NC_002927.3|:855369-856649 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGCACGCCGCCAATCCTCCCTTTCCCGACTTCGGCGCCGACGCGGCGGCCGACCCCGGCGCGGCCAGCC
GGCTGCGCCCGCACGAGTACGTCATCAGCGGCTCCAACCCGCTGGTGGCGGCGGCCAATCCGCTGCTGGA
CCTGATCCCGCAGATCCGCGCCACCACGGCCCATCCCGCGCCGGCCATGCTGCGCGAGTACCTGGTCGAC
GAAGTGCGCCAGTTCGAGCTGCGCGCGCAACAGGCCGGCATTCCCAACGAAACCATCCTGGGCGCGCGCT
ACTGCCTGTGCACGGCGCTGGACGAGGCCGCCGCGCTCACGCCGTGGGGCGGGGGCGGCGTATGGTCGGC
GCACAGCCTGCTGGTGACGTTCCATAACGAAACCTGGGGCGGCGAGAAGTTCTTCCAGCTGCTGGCCAAG
CTGTCGCAGAACCCGGGCCAGCACCTGGATTTGCTGGAGCTGTTGTACTACTGCCTGCTGCTGGGCTTCG
AGGGCCGCTACCGCGTCATCGACAACGGCCGCACGCAGCTCGAGACCTTGCGCCAGCGCCTGCTGCGCAT
CCTGCGCGGCGCGCGCGGCGAGTATCCGCGCGCGCTCTCGCCGCATTGGCGCGACACGCCGGTGCAGCAG
GCGCTGCGCCGCCTGCCGGTGCCGCTGTGGGCCTACGGGGCGCTGGCGGCGGCGCTGGCGCTGGCGTTGT
TCTGGGGCCTGTCGTGGCGCCTGGGCGAACGCTCGGATGCCGTGTTCGCCGCGGTCGCGCGGCTCAAGCC
GCCCACGGTGCAGATCGCCCCGGCGCCGCGCCCGGCGCCCGCGCCCCGCCTGGCCGTGTTCCTGCAACCC
GAGGTGCGCGACCGCCTGGTGACGGTGCGCGACGAGGTCGATCGCAGCGTGGTGGTGCTGCGCGGCGACG
GGCTGTTCGAGTCGGGCGCGGTCGCGGTGCGCGACCGCTATGCGCCGGTGCTGGCGCGGGTGGCCGAGGC
GCTGGGCCAGACGCGCGGCGATATCGTGGTGCGCGGCTATACCGACAACGTGCCCATCCGCACGGCGCGC
TTTCCGTCCAACTGGCATCTGTCGCAGGCGCGCGCCGAGGCGGTCAAGGCGGTGATCGACGCGCGCCTGG
GCCAGGCCGGACGCGTGCGCGCAGAAGGGCGCGGCGAGGCCGATCCGCTGGCCCCCAATGACACCCCCGC
CGGACGCTCGGTCAACCGGCGGGTCGAAATTACCGTGATGGTGCCGCCGGCGCCGCATGCCCGCACGCCC
GAAGAAGGAGCCACGCCATGA