SecReT6
Protein ID: 336173376
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2241
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2506854..2509328 [+]
ProductATPase AAA-2 domain-containing protein
NoteClpV
UniProt IDF6GGN6
KEGG IDlan:Lacal_2241
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-44, Aligned region: 206..294
AAA_2 [PF07724], Evalue: 1.40E-44, Aligned region: 480..521
AAA_2 [PF07724], Evalue: 1.40E-44, Aligned region: 563..725
AAA [PF00004], Evalue: 1.30E-20, Aligned region: 209..320
AAA [PF00004], Evalue: 1.30E-20, Aligned region: 440..492
AAA [PF00004], Evalue: 1.30E-20, Aligned region: 569..675
ClpB_D2-small [PF10431], Evalue: 1.50E-20, Aligned region: 732..810
AAA_5 [PF07728], Evalue: 1.10E-16, Aligned region: 208..292
AAA_5 [PF07728], Evalue: 1.10E-16, Aligned region: 567..687
AAA_16 [PF13191], Evalue: 1.70E-11, Aligned region: 187..224
AAA_16 [PF13191], Evalue: 1.70E-11, Aligned region: 254..292
AAA_16 [PF13191], Evalue: 1.70E-11, Aligned region: 471..492
AAA_16 [PF13191], Evalue: 1.70E-11, Aligned region: 537..604
AAA_14 [PF13173], Evalue: 1.80E-10, Aligned region: 206..342
AAA_14 [PF13173], Evalue: 1.80E-10, Aligned region: 432..469
AAA_14 [PF13173], Evalue: 1.80E-10, Aligned region: 569..663
AAA_22 [PF13401], Evalue: 3.10E-09, Aligned region: 205..303
AAA_22 [PF13401], Evalue: 3.10E-09, Aligned region: 403..462
AAA_22 [PF13401], Evalue: 3.10E-09, Aligned region: 498..518
AAA_22 [PF13401], Evalue: 3.10E-09, Aligned region: 566..591
Sigma54_activat [PF00158], Evalue: 4.10E-09, Aligned region: 204..294
Sigma54_activat [PF00158], Evalue: 4.10E-09, Aligned region: 568..673
IstB_IS21 [PF01695], Evalue: 1.10E-08, Aligned region: 205..328
IstB_IS21 [PF01695], Evalue: 1.10E-08, Aligned region: 568..594
NACHT [PF05729], Evalue: 5.60E-07, Aligned region: 209..336
NACHT [PF05729], Evalue: 5.60E-07, Aligned region: 569..591
Arch_ATPase [PF01637], Evalue: 2.00E-06, Aligned region: 189..230
Arch_ATPase [PF01637], Evalue: 2.00E-06, Aligned region: 414..485
Arch_ATPase [PF01637], Evalue: 2.00E-06, Aligned region: 570..588
Arch_ATPase [PF01637], Evalue: 2.00E-06, Aligned region: 629..649
AAA_18 [PF13238], Evalue: 3.80E-06, Aligned region: 209..285
AAA_18 [PF13238], Evalue: 3.80E-06, Aligned region: 569..593
T2SE [PF00437], Evalue: 1.60E-05, Aligned region: 182..226
T2SE [PF00437], Evalue: 1.60E-05, Aligned region: 565..641
Bac_DnaA [PF00308], Evalue: 2.60E-05, Aligned region: 209..375
Bac_DnaA [PF00308], Evalue: 2.60E-05, Aligned region: 567..592
AAA_17 [PF13207], Evalue: 3.10E-05, Aligned region: 16..71
AAA_17 [PF13207], Evalue: 3.10E-05, Aligned region: 209..250
AAA_17 [PF13207], Evalue: 3.10E-05, Aligned region: 568..605
AAA_19 [PF13245], Evalue: 3.60E-05, Aligned region: 207..230
AAA_19 [PF13245], Evalue: 3.60E-05, Aligned region: 387..420
AAA_19 [PF13245], Evalue: 3.60E-05, Aligned region: 570..590
AAA_10 [PF12846], Evalue: 4.30E-05, Aligned region: 207..234
AAA_10 [PF12846], Evalue: 4.30E-05, Aligned region: 271..300
AAA_10 [PF12846], Evalue: 4.30E-05, Aligned region: 566..600
AAA_24 [PF13479], Evalue: 0.00013, Aligned region: 208..226
AAA_24 [PF13479], Evalue: 0.00013, Aligned region: 571..591
MMR_HSR1 [PF01926], Evalue: 0.00023, Aligned region: 209..295
AAA_25 [PF13481], Evalue: 0.00033, Aligned region: 209..230
AAA_25 [PF13481], Evalue: 0.00033, Aligned region: 555..592
Zeta_toxin [PF06414], Evalue: 0.0004, Aligned region: 207..224
Zeta_toxin [PF06414], Evalue: 0.0004, Aligned region: 320..377
Zeta_toxin [PF06414], Evalue: 0.0004, Aligned region: 567..617
RNA_helicase [PF00910], Evalue: 0.00052, Aligned region: 209..231
RNA_helicase [PF00910], Evalue: 0.00052, Aligned region: 568..589
Mg_chelatase [PF01078], Evalue: 0.00063, Aligned region: 206..245
Mg_chelatase [PF01078], Evalue: 0.00063, Aligned region: 567..590
AAA_23 [PF13476], Evalue: 0.001, Aligned region: 205..439
AAA_23 [PF13476], Evalue: 0.001, Aligned region: 566..585
AAA_28 [PF13521], Evalue: 0.0012, Aligned region: 209..229
AAA_28 [PF13521], Evalue: 0.0012, Aligned region: 382..412
AAA_28 [PF13521], Evalue: 0.0012, Aligned region: 568..586
Miro [PF08477], Evalue: 0.0017, Aligned region: 209..247
Miro [PF08477], Evalue: 0.0017, Aligned region: 407..479
Miro [PF08477], Evalue: 0.0017, Aligned region: 570..590
ABC_tran [PF00005], Evalue: 0.0019, Aligned region: 208..228
ABC_tran [PF00005], Evalue: 0.0019, Aligned region: 569..605
Sigma54_activ_2 [PF14532], Evalue: 0.0025, Aligned region: 204..319
Sigma54_activ_2 [PF14532], Evalue: 0.0025, Aligned region: 567..588
UPF0079 [PF02367], Evalue: 0.0027, Aligned region: 42..72
UPF0079 [PF02367], Evalue: 0.0027, Aligned region: 209..229
UPF0079 [PF02367], Evalue: 0.0027, Aligned region: 568..593
FtsK_SpoIIIE [PF01580], Evalue: 0.0032, Aligned region: 201..240
AAA_3 [PF07726], Evalue: 0.0054, Aligned region: 209..229
AAA_3 [PF07726], Evalue: 0.0054, Aligned region: 574..666
MetRS-N [PF09635], Evalue: 0.0063, Aligned region: 90..103
MetRS-N [PF09635], Evalue: 0.0063, Aligned region: 577..612
DUF2075 [PF09848], Evalue: 0.0065, Aligned region: 208..285
DUF2075 [PF09848], Evalue: 0.0065, Aligned region: 439..495
DUF2075 [PF09848], Evalue: 0.0065, Aligned region: 567..590
KaiC [PF06745], Evalue: 0.0095, Aligned region: 194..231
KaiC [PF06745], Evalue: 0.0095, Aligned region: 261..294
KaiC [PF06745], Evalue: 0.0095, Aligned region: 561..582
Protein Sequence: 824 a.a.     [Download]
>gi|336173376|ref|YP_004580514.1| ATPase AAA-2 domain-containing protein [Lacinutrix sp. 5H-3-7-4]
MADYALSSKLKEALHIAQAIAKEYSNKQYSSAHVLKALMHKSIGMIKYLESIDQDGYYVEEWAEVRLESL
PKTNKVPENPSADDSVEAVLYEADNIKLKLGLEEVTEHCVLIALCTPGVGFSFEQLKSFSLTPNEIIDNI
GVKEDGTVSAPAGTTSKKQNKAVGTGTLSQYCIDKTSGASNNELDQISGRESEIKMIGEILGRRSKPNVL
ILGDPGVGKTVLFNGLAYASVNNNVPEHLKSARIYELDFINLVSGAGYKGEIEDRFKKVIEEIKQFPKAI
LLIDEINNLTDKNQGNQGLANLLKSELVKGELTVIGTATNDAFRKYIEVDEGLARQFETVRLIEPSEDEA
YRMIKNTISYYTDHHKLTIDSETINEAIRLAKRYNKERSLPDSAIDLIDRTMSAAKYMIETSVDEIETIK
QHLEALKEDTEFTEEELLKEQTWQYALMKNRLSYLLFDELGDDNHFEDVKTSKAGFKAMESMLNQLHEVA
SQEKTSINKNDVASTIANKTGIPTGKLQADEKERLLNMETVLQRRVIGQDHAISVITSAVLESRSGLSKP
GLPVGSFFFSGPTGTGKTELAKSLAEFLFQDENAIIRFDMSEFKEEHSAALLYGAPPGYVGYEEGGLLVN
KIRQKPYSIVLFDEIEKAHPSVFDIFLQILDEGKLSDRLGKVGDFSNAVILFTSNIGSQHIVDSFDQGII
PKSNDLLEIMGSYFRPEFLGRLTEIIPFSPITKENVVKIFKIQLQGLLKALGKQDISLEISNDAMEHLAI
KGFTPKYGARPLRGVIRTDLRSPLSRMIISGDITKGAKVSLKLNKEKELEWQYK
 
Nucleotide Sequence: 2475 bp     [Download]
>gi|336171143|ref|NC_015638.1|:2506854-2509328 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGGCAGATTATGCACTATCAAGCAAGTTAAAAGAAGCATTACATATTGCTCAAGCAATTGCAAAAGAAT
ATTCAAATAAACAATACTCATCTGCACACGTATTAAAAGCCTTAATGCACAAAAGTATAGGCATGATTAA
GTACTTAGAAAGTATAGATCAAGATGGTTACTATGTAGAAGAATGGGCAGAAGTAAGGTTAGAATCTTTA
CCAAAAACCAATAAAGTACCAGAAAATCCTTCAGCAGACGATAGTGTAGAAGCAGTGCTGTATGAAGCCG
ATAATATAAAACTAAAACTAGGCTTAGAGGAAGTAACAGAGCATTGTGTGCTAATTGCATTATGTACGCC
AGGCGTAGGTTTTTCATTCGAGCAATTAAAATCATTTTCATTAACACCTAATGAGATTATAGATAATATA
GGCGTAAAAGAAGATGGCACAGTAAGTGCACCAGCAGGAACAACTTCAAAAAAACAAAACAAAGCTGTTG
GTACAGGTACACTTTCACAATATTGTATAGACAAAACTTCTGGAGCAAGTAATAATGAGTTAGACCAAAT
TTCTGGAAGAGAATCTGAAATTAAAATGATAGGCGAAATTTTAGGTCGTCGCTCTAAACCAAATGTTTTA
ATTCTTGGAGATCCAGGTGTTGGTAAAACGGTTTTATTTAATGGTTTAGCCTATGCCTCTGTAAATAATA
ATGTACCAGAACATTTAAAAAGTGCGAGAATCTATGAATTAGATTTTATAAACTTAGTTTCTGGTGCAGG
TTATAAAGGTGAAATAGAAGATAGGTTTAAAAAGGTTATAGAAGAAATAAAACAATTTCCAAAAGCAATT
TTATTAATTGATGAAATTAATAATTTAACCGATAAAAACCAGGGAAATCAAGGCTTAGCAAATTTATTAA
AGTCTGAGTTGGTAAAAGGAGAACTTACCGTAATAGGTACAGCAACAAATGATGCTTTTAGAAAATATAT
AGAAGTAGACGAAGGTTTAGCAAGACAATTTGAAACGGTAAGATTAATAGAGCCAAGTGAAGATGAAGCT
TACCGTATGATAAAAAATACCATTTCTTATTATACAGACCATCACAAGTTAACAATAGATTCTGAAACTA
TAAATGAAGCTATAAGACTCGCAAAGCGTTATAATAAAGAACGAAGTTTGCCAGACTCTGCTATAGATTT
AATAGACAGAACAATGTCTGCAGCAAAATACATGATAGAAACATCTGTAGATGAAATTGAAACAATAAAA
CAACATTTAGAAGCATTAAAAGAAGATACTGAATTTACAGAAGAAGAGTTGCTAAAAGAGCAAACATGGC
AATATGCTTTAATGAAAAACAGGTTGAGTTATTTATTGTTTGATGAGTTAGGAGACGATAACCATTTTGA
AGACGTAAAAACATCTAAAGCAGGTTTTAAAGCCATGGAAAGCATGCTTAACCAATTGCATGAAGTTGCT
TCTCAAGAAAAAACAAGTATAAACAAAAACGATGTAGCCTCAACAATAGCAAATAAAACAGGAATACCAA
CAGGTAAGTTACAAGCCGATGAAAAAGAGCGATTACTTAATATGGAAACCGTTTTACAACGTCGAGTTAT
AGGTCAAGATCATGCAATAAGTGTAATAACATCAGCAGTTTTAGAATCTAGATCGGGTTTAAGTAAACCA
GGATTACCAGTAGGATCGTTTTTCTTTTCTGGACCAACAGGAACAGGAAAAACCGAATTAGCAAAATCAC
TAGCCGAATTTTTATTTCAAGACGAAAATGCAATAATCCGTTTTGATATGAGTGAGTTTAAAGAAGAACA
CTCTGCAGCCTTACTATATGGTGCGCCTCCAGGATATGTAGGTTATGAAGAAGGCGGATTACTAGTAAAT
AAAATAAGGCAGAAACCATATTCTATTGTCCTTTTTGATGAAATAGAAAAAGCACATCCATCGGTTTTTG
ATATTTTTCTTCAAATATTAGACGAAGGAAAACTTAGCGACCGTTTAGGTAAAGTTGGAGATTTCTCTAA
TGCAGTAATACTATTTACATCCAATATAGGCAGCCAACATATAGTAGACTCTTTCGATCAAGGTATTATA
CCAAAATCTAACGATTTGCTAGAAATAATGGGAAGCTATTTTAGACCAGAATTTTTAGGAAGACTAACAG
AAATTATCCCGTTTTCTCCAATAACAAAAGAGAATGTGGTTAAAATATTTAAAATACAATTACAAGGATT
GCTAAAAGCCTTAGGCAAACAAGATATAAGTTTAGAAATATCTAACGATGCAATGGAGCATTTAGCAATA
AAAGGCTTTACACCAAAATATGGTGCAAGACCACTACGTGGCGTAATTCGTACAGATTTGAGATCGCCAT
TATCAAGAATGATTATTTCTGGAGACATAACAAAAGGAGCCAAAGTAAGCCTAAAACTCAACAAAGAAAA
AGAATTAGAGTGGCAATATAAATAA