SecReT6
Protein ID: 336173377
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2242
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2509382..2509828 [+]
Producthypothetical protein
NoteTssB
UniProt IDF6GGN7
KEGG IDlan:Lacal_2242
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 0.0032, Aligned region: 49..137
QRPTase_N [PF02749], Evalue: 0.0057, Aligned region: 42..77
Protein Sequence: 148 a.a.     [Download]
>gi|336173377|ref|YP_004580515.1| hypothetical protein [Lacinutrix sp. 5H-3-7-4]
MDTYGLGGTEVKTDANEAIQEIPQNRTLFVEKLTQDQPIKPEVVTGLKTVEEVFEHYKPEVEVDFEDADG
VEKKEALNFKNLGDFGGKGITRQSKFLKDLNTEKDQYLKIVKQLKTNKILKTALENPEAKESLLEAIRAL
LTEIQENK
 
Nucleotide Sequence: 447 bp     [Download]
>gi|336171143|ref|NC_015638.1|:2509382-2509828 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGGACACTTACGGATTGGGCGGCACAGAAGTAAAAACTGATGCTAATGAAGCCATACAAGAAATACCTC
AAAACAGAACACTTTTTGTAGAGAAGTTAACTCAAGATCAGCCTATAAAACCAGAAGTGGTTACAGGACT
TAAAACGGTAGAAGAAGTTTTTGAACACTACAAGCCAGAAGTAGAAGTAGATTTTGAAGATGCCGATGGC
GTTGAAAAAAAAGAAGCGCTAAATTTTAAAAATTTAGGCGATTTTGGTGGAAAAGGTATTACTCGACAAA
GTAAATTTTTAAAAGATTTAAATACCGAAAAAGACCAATACCTAAAAATTGTAAAACAACTAAAAACTAA
CAAAATATTAAAGACTGCTTTAGAAAACCCAGAAGCTAAAGAATCTTTATTAGAAGCTATTCGCGCATTA
TTAACCGAAATCCAAGAAAACAAATAA