SecReT6
Protein ID: 336173378
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2243
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2509831..2511183 [+]
Producthypothetical protein
NoteTssC
UniProt IDF6GGN8
KEGG IDlan:Lacal_2243
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-15, Aligned region: 115..240
DUF877 [PF05943], Evalue: 1.60E-15, Aligned region: 281..425
Phage_sheath_1 [PF04984], Evalue: 2.50E-05, Aligned region: 265..432
Protein Sequence: 450 a.a.     [Download]
>gi|336173378|ref|YP_004580516.1| hypothetical protein [Lacinutrix sp. 5H-3-7-4]
MASPEQKGQFTPVENPAQYLKEKSESLAKYGGFDLLESCIEGVQNMNPERKARKKIFLTENSKTEDREQL
KKVLEIWSSVLGGAENISDMVEASEEKSQVANGLLKKNLNKALESTNELERSYRSMALFYKNTESDKLKN
ISIMNAELDQVKDLDNTRFIDAIAEELKSTYDRLDLRDNYGLLVIPGYLGSNKVVEKWAKIAHENKAMLV
TDFEHLDEPDDVMEMFEAANLTSGDKYKSNVIMACNWLVGRGKVDEVGEEDDLYVPPAGALAGKIYNTLM
SQVTAGKKFGGINEIDGVRFDLKKSEIAHLEKMGLVPMVNEYGKVMAFSAKTLFNGDNLGLQTYSVVRVF
DYVTKVLMDFLNRRAFENFNAKTRKELMGQIVKFLDGITGPDKLIEDFSIKRFEQDPNQKDRVFLDIHMT
PYFPAKNFMIKMDGQKGDDGTEWDAEYEQQ
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|336171143|ref|NC_015638.1|:2509831-2511183 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGGCATCACCAGAACAAAAAGGACAATTTACTCCAGTAGAAAATCCCGCGCAATACTTAAAAGAAAAAA
GCGAAAGCTTAGCTAAATATGGCGGTTTCGATTTGTTAGAGTCTTGCATTGAAGGTGTTCAAAATATGAA
TCCGGAGCGTAAGGCAAGAAAAAAAATATTTCTTACAGAAAATAGTAAAACCGAAGATAGAGAACAACTT
AAAAAAGTATTAGAAATTTGGTCATCGGTTTTAGGTGGTGCAGAAAATATTTCTGATATGGTTGAAGCAT
CAGAAGAAAAGTCTCAAGTTGCTAATGGGTTATTAAAAAAGAACCTTAATAAAGCTTTAGAATCTACTAA
TGAATTAGAACGTTCTTACCGTTCTATGGCTTTATTTTATAAAAATACCGAGTCTGATAAGTTAAAGAAC
ATTTCTATAATGAACGCAGAGCTAGATCAAGTTAAAGATTTAGACAATACACGTTTTATAGATGCTATAG
CAGAAGAATTAAAATCTACTTACGATAGATTAGATTTAAGAGATAACTACGGTTTATTAGTAATACCAGG
TTATTTAGGATCTAATAAAGTTGTAGAAAAATGGGCTAAAATTGCACACGAAAATAAAGCCATGTTAGTA
ACAGATTTTGAGCACTTAGATGAGCCAGATGATGTTATGGAAATGTTTGAAGCTGCAAATTTAACTAGTG
GAGATAAATATAAGTCTAATGTAATAATGGCTTGTAACTGGTTAGTTGGTAGAGGTAAAGTGGATGAAGT
AGGAGAGGAAGATGATTTATACGTACCACCAGCAGGAGCTTTAGCGGGTAAAATATATAATACATTAATG
TCTCAAGTTACTGCCGGTAAAAAGTTTGGTGGTATTAACGAAATTGATGGTGTACGTTTTGACCTTAAAA
AAAGTGAAATTGCGCATTTAGAAAAAATGGGATTAGTACCTATGGTAAACGAGTATGGTAAAGTAATGGC
ATTTTCTGCTAAAACTTTATTTAATGGTGATAACCTTGGGTTACAAACATACTCTGTAGTAAGAGTATTC
GATTACGTTACAAAAGTATTAATGGATTTCTTAAACCGTCGTGCTTTCGAAAACTTTAATGCAAAAACTA
GAAAAGAATTAATGGGACAAATTGTTAAGTTTTTAGATGGTATTACAGGACCAGATAAACTTATTGAAGA
CTTTTCTATTAAACGTTTCGAGCAAGATCCAAACCAAAAAGATCGTGTGTTTTTAGATATACACATGACA
CCTTATTTTCCAGCCAAAAACTTTATGATTAAAATGGACGGACAAAAAGGAGATGATGGTACAGAATGGG
ATGCAGAATATGAGCAACAATAA