SecReT6
Protein ID: 336173391
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2258
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2523131..2524897 [-]
ProductRhs element Vgr protein
NoteVgrG
UniProt IDF6GGQ1
KEGG IDlan:Lacal_2258
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.00E-19, Aligned region: 40..331
Phage_GPD [PF05954], Evalue: 4.00E-19, Aligned region: 525..552
Phage_base_V [PF04717], Evalue: 2.10E-18, Aligned region: 370..445
Protein Sequence: 588 a.a.     [Download]
>gi|336173391|ref|YP_004580529.1| Rhs element Vgr protein [Lacinutrix sp. 5H-3-7-4]
MAILSTTYIHINGNQLPYYNSCSLHQEIGGHHILNLTCLQETIDFFCNNNNIEIHDLLAAIITVETKSFA
DIDFHGTLKFKGIITSLNHNKGLYGTDGNLVAIEAKSTTIISDDGPHHTSFNDMSFVDIIEDNFSSYDTS
KLKINTKNSKLTEPLIYTVQYNESCFAFAQRMAARNGEWMYYNGEELVFGIDTNTEETELKLGRDLQDYS
TSLKPVAQNFKYFTNDYIANDIHEAESSATTSASEGHFTVVNDSSKDIYTKPTRIWLNISDDSKSKSRLD
KYADLQQQSLQSNQVVVSGTSDNPGVMLASTIKISESTYRVTKVIHSYSSNGEYENYFEAASTNVDVYPK
TKINAFPMAHSQTAKVIENHDPEGMGRVKVQFPWQKPDGLTTPWIRSISPSASQGQGFFFIPEVDDEVLV
DFEGGNAEAPFVMGGVYNSQSIPPDGSANENNHIKMLKTRSGSFFKLNDEDGSITIQDKAGSSIVLDGSG
NIQITAVSNVSVTGPESVSTSADAVSTDAGTSISQTSGKTYSVSSGEEASIIAGKKVAVNGATQVTVDST
DVAITGTAKATVSSSGTTAVEGTIIKLN
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|336171143|ref|NC_015638.1|:c2524897-2523131 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGGCAATTTTATCTACAACTTATATTCACATAAACGGAAATCAACTTCCATACTATAATAGTTGTAGTT
TACATCAGGAAATTGGCGGTCATCACATATTAAATTTAACCTGCCTGCAAGAAACTATCGATTTTTTTTG
CAACAACAACAATATAGAAATTCACGATTTATTAGCTGCTATAATTACTGTAGAAACTAAATCTTTTGCA
GATATAGATTTTCACGGTACACTAAAATTTAAAGGTATAATTACAAGCTTAAACCATAACAAAGGCTTAT
ATGGAACAGATGGTAACTTAGTTGCCATTGAAGCAAAAAGTACAACCATAATATCAGACGATGGTCCACA
CCATACCTCTTTTAATGATATGAGTTTTGTAGATATTATAGAAGATAATTTTAGTAGTTACGACACCTCA
AAATTAAAAATAAATACAAAAAATTCTAAACTAACAGAACCTTTAATATATACCGTACAATACAATGAAA
GTTGTTTTGCTTTTGCACAACGTATGGCAGCTAGAAATGGTGAATGGATGTATTATAATGGTGAAGAATT
AGTTTTTGGAATAGATACCAATACCGAAGAAACAGAACTTAAACTAGGAAGAGACTTACAAGACTATAGT
ACCTCTTTAAAACCTGTAGCACAAAATTTTAAATATTTTACCAACGATTATATTGCTAACGATATTCATG
AAGCAGAATCCTCTGCTACAACTAGCGCTAGCGAAGGTCATTTTACTGTGGTTAACGACAGTTCTAAAGA
TATTTATACAAAACCAACTAGAATTTGGCTAAACATATCAGACGATTCAAAATCAAAAAGCCGTTTAGAT
AAATATGCCGATTTACAACAACAATCTTTACAGAGCAATCAAGTAGTAGTATCAGGAACATCAGACAATC
CTGGTGTTATGCTCGCATCAACAATAAAAATATCAGAAAGCACATATAGGGTTACCAAAGTAATACACTC
CTACTCTAGCAATGGAGAATACGAAAATTATTTTGAAGCCGCATCTACAAACGTAGATGTATACCCAAAA
ACAAAAATTAACGCGTTCCCAATGGCACACAGCCAAACCGCAAAGGTTATAGAAAATCATGATCCAGAAG
GCATGGGACGCGTAAAAGTTCAATTTCCATGGCAAAAACCAGACGGTTTAACAACACCATGGATTAGAAG
TATTTCACCAAGCGCATCACAAGGTCAAGGATTTTTCTTTATACCAGAAGTAGATGACGAAGTCCTTGTA
GACTTTGAAGGTGGTAATGCCGAAGCGCCTTTTGTAATGGGTGGCGTTTATAACTCACAATCTATTCCGC
CAGACGGCAGCGCTAATGAAAATAACCACATTAAAATGCTTAAAACAAGAAGTGGTTCATTTTTTAAATT
AAACGATGAAGATGGTAGTATTACCATACAAGATAAAGCAGGTAGTTCTATAGTTTTAGATGGTAGTGGG
AATATTCAAATAACTGCCGTTAGCAATGTATCTGTAACAGGACCAGAATCTGTTTCTACAAGTGCAGATG
CAGTATCTACAGATGCTGGCACTTCTATATCACAAACTAGCGGTAAAACTTACTCTGTTTCTAGTGGAGA
AGAAGCCAGTATAATAGCAGGAAAAAAAGTGGCTGTTAATGGTGCAACTCAAGTTACTGTAGACTCTACA
GATGTTGCTATAACAGGAACAGCTAAAGCAACAGTAAGTTCGTCTGGTACTACGGCAGTAGAAGGTACTA
TTATTAAACTTAACTAG