SecReT6
Protein ID: 336173392
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2259
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2524918..2525316 [-]
Producthypothetical protein
NoteHcp
UniProt IDF6GGQ2
KEGG IDlan:Lacal_2259
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 132 a.a.     [Download]
>gi|336173392|ref|YP_004580530.1| hypothetical protein [Lacinutrix sp. 5H-3-7-4]
MSFLAKLTIDDQEFNVLSFSFDVNQQVNHGSARPTGLAIINHIHISIESAENSGFFGWSVNSYEQKDGEI
VFYKRDAMASSRTLKFTGAFCVNYNEVFQSNSANPMITNLVLTVETLELDDTLYINPSIKNL
 
Nucleotide Sequence: 399 bp     [Download]
>gi|336171143|ref|NC_015638.1|:c2525316-2524918 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGTCTTTTTTAGCAAAATTAACCATAGATGATCAAGAATTTAATGTCTTATCATTTTCTTTTGATGTTA
ACCAACAAGTTAACCATGGCTCTGCAAGACCTACAGGTTTAGCAATAATAAATCATATTCACATATCTAT
AGAATCTGCAGAAAATTCTGGTTTTTTTGGCTGGAGTGTTAATAGTTACGAGCAAAAAGATGGTGAAATT
GTGTTTTATAAAAGAGACGCTATGGCAAGCTCCAGAACCTTAAAGTTTACTGGTGCTTTTTGTGTTAATT
ATAATGAAGTATTTCAAAGTAACAGTGCAAACCCAATGATTACTAATTTAGTTCTAACTGTAGAAACATT
AGAATTAGACGATACTTTATATATAAACCCATCTATAAAAAATTTATAA