SecReT6
Protein ID: 336173393
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2260
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2525420..2525806 [-]
Producthypothetical protein
NoteHcp
UniProt IDF6GGQ3
KEGG IDlan:Lacal_2260
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|336173393|ref|YP_004580531.1| hypothetical protein [Lacinutrix sp. 5H-3-7-4]
MSFKAKLTVGGKEYNVLNCRYKLHQEVDATGRPSSITRGGQFEVTVESTADTTLSDWMFNNFERKDGTIT
FLKRDTDAKAKELEFKEGYAVQYSEEFDHKGDNPMAETIVISAKTLKMGNGEHVNEWV
 
Nucleotide Sequence: 387 bp     [Download]
>gi|336171143|ref|NC_015638.1|:c2525806-2525420 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGTCATTTAAAGCAAAATTAACTGTAGGAGGAAAAGAGTACAACGTATTAAACTGCCGCTACAAATTAC
ATCAAGAAGTTGATGCAACAGGACGTCCATCATCAATCACAAGAGGCGGACAATTTGAAGTTACTGTAGA
GTCTACTGCAGACACTACATTATCAGATTGGATGTTTAACAACTTTGAGCGTAAAGATGGTACTATCACA
TTCTTAAAAAGAGATACAGACGCTAAAGCCAAAGAATTAGAATTTAAAGAAGGTTATGCTGTACAATATT
CTGAAGAATTTGATCATAAAGGAGACAACCCAATGGCTGAAACTATTGTAATCTCTGCTAAAACCTTAAA
AATGGGTAACGGCGAGCACGTTAACGAATGGGTTTAA