SecReT6
Protein ID: 336173394
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2261
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2525959..2526834 [-]
Producthypothetical protein
NoteTssN
UniProt IDF6GGQ4
KEGG IDlan:Lacal_2261
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 291 a.a.     [Download]
>gi|336173394|ref|YP_004580532.1| hypothetical protein [Lacinutrix sp. 5H-3-7-4]
MNTVTNIMNGNMFKVSLGLFFISSIIMGLMKKIRTVFAKNKKAGILYLLFIIVTFALTGLLSSSFVLNDT
PLNSFIGIQIIFLILGILHIYVIDKFFPDLTKDKSGIFHELLFTIIVLCLGLIVYLNVVNRFRPSFSFTF
LGASIVFLIPFLFNKLYKFAYNIPVSVYNKWIYPLDNSIKEPTKNELTNPAVISFEFQKNNDDKDITNFR
IKAPENMDFGKLFYFFINDYNERHPESKIEYLNPATMQPQQWIFFFKPNWLGNLKHIDYNKTVSHNNVKE
NDVIVCQRVND
 
Nucleotide Sequence: 876 bp     [Download]
>gi|336171143|ref|NC_015638.1|:c2526834-2525959 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGAATACAGTAACTAACATAATGAACGGAAACATGTTTAAAGTAAGTTTAGGCTTATTTTTTATCAGCT
CTATTATTATGGGCTTAATGAAAAAAATAAGAACCGTATTTGCAAAAAACAAAAAAGCAGGAATTCTTTA
TTTACTTTTTATAATTGTAACTTTTGCTTTAACAGGTTTACTTAGTTCTAGTTTTGTTTTAAACGATACA
CCGTTAAATAGTTTTATTGGTATTCAAATTATATTTTTAATATTAGGTATTTTACATATATATGTAATAG
ATAAATTCTTTCCAGACCTAACTAAAGACAAATCAGGTATTTTTCACGAACTTTTATTTACTATAATAGT
TTTATGCTTAGGTTTAATTGTCTATTTAAATGTTGTAAACCGTTTTAGACCTTCATTTAGTTTCACATTT
CTTGGAGCAAGTATTGTGTTTTTAATTCCATTTTTATTCAATAAACTATACAAATTCGCATATAATATTC
CTGTTTCAGTATATAACAAATGGATATACCCTTTAGATAACAGTATAAAAGAGCCTACAAAAAACGAGCT
TACCAATCCTGCTGTTATTAGTTTCGAATTTCAAAAAAACAACGACGATAAAGACATTACAAACTTTAGA
ATTAAAGCACCAGAAAATATGGATTTTGGTAAACTATTCTACTTCTTTATAAACGATTATAATGAGCGTC
ATCCAGAAAGTAAAATAGAATATTTAAATCCTGCAACAATGCAACCTCAACAGTGGATCTTTTTTTTCAA
ACCAAATTGGTTAGGTAATTTAAAACATATAGATTACAATAAAACTGTAAGCCACAATAATGTAAAAGAA
AATGATGTAATTGTTTGCCAAAGAGTAAACGACTAA