SecReT6
Protein ID: 336173403
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2270
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2534428..2536233 [-]
ProductRhs element Vgr protein
NoteVgrG
UniProt IDF6GGR3
KEGG IDlan:Lacal_2270
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 6.00E-17, Aligned region: 167..182
Phage_base_V [PF04717], Evalue: 6.00E-17, Aligned region: 369..443
Phage_GPD [PF05954], Evalue: 6.20E-16, Aligned region: 47..227
Protein Sequence: 601 a.a.     [Download]
>gi|336173403|ref|YP_004580541.1| Rhs element Vgr protein [Lacinutrix sp. 5H-3-7-4]
MAILSTTNININGNKLPYYNSCNLEQEIGKHHTMHLHCLIETIETFCADNNIEIDDLLGAPITIETSSFA
KMDFLGALKFKGLITAINFQKGLYNNEGDYIEFNIQSPTILSDDGSHYTSYSEMSFVEIIKKNFNDYDAS
KLSVNTKNATLNSPLLYTVQSNESCFEFAQRLAAKYGEWMFFNGEELVFGLPSSNKEIELKFGRDLNSFT
TQLAPKPQNFNYFSSNYIENITHEKKSAKNGSTNNGYFNVVNRNSKDLFSKKTTIWANIQNDTTSKTQLD
SAVEKHQKAIESNQIKIYASCDNPGIKLTSVVKILNNLYRVVKVTHDYKSNGEYNNTFEAVSINVEAYPY
TNITAIAKSPSQMATVIDNVDPENLGRIKVQFPWQKENGLTTPWIRIVSPHAGKDKGFHFIPEKDEEVLI
GFEGDYAEKPYVLGSLYHSQAKPDSWKTNSNNIKAIRTRSGHTIELNDTGGTESITITDINKNLINIDTA
NNNITITALENMTLNSKNMQINVQENLDLNVGNTKTEIIQKDKTEKITGNHNINSNNSTEQVANNKTLTA
GSNYNQSSANAKMLATKGDLTIHASGVSTFQGSADVKISKG
 
Nucleotide Sequence: 1806 bp     [Download]
>gi|336171143|ref|NC_015638.1|:c2536233-2534428 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGGCTATTTTATCTACTACAAATATTAATATTAACGGTAATAAACTTCCTTACTATAACAGTTGTAATT
TAGAGCAGGAAATTGGTAAACATCATACAATGCATTTGCATTGTTTAATAGAAACAATTGAAACATTTTG
TGCAGATAATAATATAGAAATAGACGATTTATTAGGCGCACCAATTACCATAGAAACCAGTTCTTTTGCT
AAAATGGACTTTTTAGGAGCCTTAAAATTTAAAGGCTTAATTACAGCTATAAATTTCCAAAAAGGTTTAT
ATAATAATGAGGGCGATTATATAGAGTTTAATATACAAAGTCCAACAATCCTGTCAGACGACGGTTCGCA
CTATACCTCTTATAGCGAGATGAGTTTTGTAGAAATTATTAAAAAAAATTTTAATGACTACGATGCTTCA
AAACTTTCTGTAAACACAAAAAATGCTACTTTAAACTCACCACTACTCTACACTGTTCAGTCTAACGAAA
GTTGTTTTGAATTTGCACAACGTTTAGCTGCTAAATATGGCGAATGGATGTTTTTTAATGGCGAAGAACT
TGTTTTTGGTTTACCGTCCAGCAATAAAGAAATAGAGCTTAAGTTTGGTAGAGACTTAAATAGTTTTACA
ACTCAATTAGCACCAAAACCACAAAATTTTAATTATTTTTCTAGTAATTATATAGAGAATATTACACACG
AAAAAAAGTCTGCTAAAAATGGATCAACTAATAATGGCTATTTTAATGTAGTTAATAGAAACTCTAAAGA
TCTTTTTTCAAAAAAAACAACTATTTGGGCTAACATTCAAAATGATACAACAAGCAAAACCCAATTAGAC
TCTGCTGTAGAAAAACATCAAAAAGCTATAGAAAGTAATCAAATAAAAATATATGCCTCTTGTGATAATC
CTGGTATAAAACTAACATCTGTAGTTAAAATTCTGAATAATTTATATCGAGTAGTCAAAGTTACACACGA
TTATAAAAGCAATGGAGAATATAATAATACGTTTGAAGCCGTCTCAATAAATGTAGAAGCATACCCATAT
ACTAACATAACTGCAATAGCTAAAAGTCCCTCACAAATGGCTACTGTTATAGATAATGTAGATCCAGAAA
ATTTAGGCCGAATTAAAGTGCAGTTTCCATGGCAAAAAGAAAACGGACTAACAACGCCTTGGATTCGTAT
AGTAAGTCCGCATGCAGGAAAAGATAAAGGGTTTCATTTTATACCAGAAAAAGACGAAGAAGTTTTAATT
GGTTTTGAAGGTGATTATGCCGAAAAACCTTATGTACTTGGCAGCTTGTATCACAGTCAAGCAAAGCCAG
ATAGCTGGAAAACAAATTCTAATAATATAAAAGCTATTAGAACACGATCTGGACATACCATTGAACTAAA
CGATACAGGTGGTACAGAAAGTATTACAATTACAGACATAAACAAAAACCTAATTAATATTGATACTGCT
AATAACAATATTACAATTACAGCTTTAGAAAACATGACATTAAACTCTAAAAATATGCAAATAAACGTGC
AGGAAAACTTAGATTTAAATGTTGGTAACACTAAAACAGAGATTATACAAAAAGATAAAACCGAAAAGAT
TACAGGCAATCACAATATAAACTCTAACAATAGTACAGAGCAAGTAGCAAACAATAAAACCTTAACGGCA
GGTTCAAATTACAACCAATCTTCAGCTAATGCTAAAATGTTAGCCACAAAAGGAGATTTAACCATACATG
CAAGTGGTGTTTCTACTTTTCAAGGCAGTGCAGATGTTAAAATAAGTAAAGGCTAA