SecReT6
Protein ID: 336173404
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2271
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2536493..2536879 [-]
Producthypothetical protein
NoteHcp
UniProt IDF6GGR4
KEGG IDlan:Lacal_2271
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|336173404|ref|YP_004580542.1| hypothetical protein [Lacinutrix sp. 5H-3-7-4]
MSFKTRLNVGGKEYNVLSCDYKLHQETDPTGRPSSITRGGQIKISVESTSDTSLSDWMFNNFERKDGSLT
FFKRDTDAKAKELNFTEAYMIEYTEVFDHKGDDPMTETIVISAKSISIGNGEHVNEWV
 
Nucleotide Sequence: 387 bp     [Download]
>gi|336171143|ref|NC_015638.1|:c2536879-2536493 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGTCATTTAAAACCAGATTAAATGTTGGTGGAAAAGAGTACAACGTTTTAAGTTGTGATTACAAACTTC
ACCAAGAAACAGATCCAACAGGAAGACCATCTTCTATAACTAGAGGTGGACAAATTAAAATTTCGGTTGA
ATCTACTTCAGACACTTCTTTATCAGACTGGATGTTCAATAATTTTGAACGTAAAGATGGTTCTCTAACA
TTCTTTAAAAGAGATACAGACGCCAAAGCAAAAGAATTAAACTTTACAGAAGCTTACATGATTGAATACA
CAGAAGTTTTCGACCATAAAGGCGATGACCCAATGACAGAAACTATAGTTATATCTGCAAAATCCATAAG
TATTGGTAATGGTGAGCATGTTAACGAATGGGTTTAA