SecReT6
Protein ID: 336173405
SecReT6 ID918
T6SS typeiii
Gene symbol-
Locus tagLacal_2272
StrainLacinutrix sp. 5H-3-7-4
Repliconchromosome [GenBank: NC_015638] [Browse all T6SS(s) in this replicon]
Location [Strand]2536933..2537844 [-]
Producthypothetical protein
NoteTssG
UniProt IDF6GGR5
KEGG IDlan:Lacal_2272
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 303 a.a.     [Download]
>gi|336173405|ref|YP_004580543.1| hypothetical protein [Lacinutrix sp. 5H-3-7-4]
MTSAQLEQIFEELVQVYDNVKAEVIVAELQKTTNISQEDIIINNQSTFRRSHRRDIINIGSIDDNILNLN
LSRNGLYDHLPEGLFHAKDTTKGRVSFPDLRKSYKKEEKEARHFFSPLENEFFNQKLEIENNERDLFNNF
LNLDDKFLIDFWKIDDTIPKKYLSKLIKLLPFAYKIAGDLELTKKCLEEILDKNVKITKKYSPNPVELRN
LNKDDNCLGTSFTLSKKTDYISQPYYNVEIGPIDEENVEDYIKEDGVLKFVNVFYDYFFPIEVQIKTKLN
VSYKNGFLLRKDYEPIIGLTTVI
 
Nucleotide Sequence: 912 bp     [Download]
>gi|336171143|ref|NC_015638.1|:c2537844-2536933 Lacinutrix sp. 5H-3-7-4 chromosome, complete genome
ATGACTAGCGCACAACTTGAACAAATATTTGAAGAGCTTGTACAAGTTTATGACAATGTAAAAGCCGAAG
TTATTGTAGCAGAGCTGCAAAAAACAACAAATATTAGCCAAGAGGATATAATTATAAATAACCAAAGCAC
CTTTAGAAGATCGCATAGACGTGATATTATAAATATTGGCTCTATAGATGATAATATTCTAAACTTAAAT
TTAAGTAGAAATGGTTTATACGACCATTTACCAGAAGGTTTATTTCATGCTAAGGACACAACAAAAGGTA
GAGTATCATTTCCAGATTTAAGAAAATCTTACAAAAAGGAAGAAAAAGAAGCCAGACACTTTTTCTCTCC
TTTAGAAAATGAATTTTTTAATCAGAAACTTGAGATTGAAAATAATGAGCGTGATTTATTTAATAATTTT
TTAAATCTTGATGATAAATTTTTAATAGACTTTTGGAAAATTGACGATACAATACCTAAAAAATATTTAT
CTAAACTTATAAAATTACTTCCATTTGCTTACAAAATTGCAGGCGATTTAGAGCTTACAAAAAAGTGCCT
AGAAGAAATTTTAGATAAAAATGTTAAAATCACAAAAAAATATAGTCCAAATCCTGTCGAGCTACGTAAC
TTAAATAAGGACGATAATTGTTTAGGAACAAGTTTTACACTTTCTAAAAAAACAGATTACATTTCGCAAC
CTTATTATAATGTAGAAATTGGACCAATTGACGAAGAAAATGTAGAAGACTATATTAAAGAAGATGGCGT
ATTAAAATTTGTAAACGTTTTTTACGATTATTTTTTTCCAATAGAAGTGCAAATTAAAACGAAACTTAAC
GTTAGTTATAAAAATGGATTTCTATTGCGTAAAGATTATGAACCCATTATAGGTTTAACAACCGTTATTT
AA